Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR37 IGR38 IGR35 IGR36 IGR34 rpL33, - MG055.1 MG055 MG056 nusG, - MG054 ffh, - MG048 cdd, - MG052 deoD, - MG049 metK,metX, - MG047 deoA, - MG051 manB, - MG053 rpL33, - MG055.1 MG055 MG056 nusG, - MG054 ffh, - MG048 cdd, - MG052 deoD, - MG049 metK,metX, - MG047 deoA, - MG051 manB, - MG053 Type: inverted, Name:  - 65 MG055 MG056 nusG, - MG054 ffh, - MG048 MG055.2 MG057 MG057 rpL33, - MG055.1 MG055.2 cdd, - MG052 deoD, - MG049 metK,metX, - MG047 deoA, - MG051 manB, - MG053 deoC, - MG050 deoC, - MG050
* Calculated from Protein Sequence

Gene ID: MG052

DNA Molecule Name:
1  

Genbank ID:
1045725

Gene Name:
cdd  

Definition:
cytidine deaminase

Gene Start:
61015

Gene Stop:
61404

Gene Length:
390

Molecular Weight*:
14958

pI*:
9.75

Net Charge*:
7.23

EC:
3.5.4.5  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Primary Evidence:
Tham TN, Ferris S, Kovacic R, Montagnier L, Blanchard A. 1993. Identification of Mycoplasma pirum genes involved in the salvage pathways for nucleosides. J Bacteriol 175(16):5281-5. Medline: 8349569.

Mitchell A, Finch LR. 1979. Enzymes of pyrimidine metabolism in
Mycoplasma mycoides subsp. mycoides. J Bacteriol 137(3):1073-80. Medline: 220209.

Hamet M, Bonissol C, Cartier P. 1979. Activities of enzymes of purine and pyrimidine metabolism in nine Mycoplasma species. Adv Exp Med Biol 122B:231-5. Medline: 232630.

Secondary Evidence:
Carlow DC, Carter CW Jr, Mejlhede N, Neuhard J, Wolfenden R. 1999. Cytidine deaminases from B. subtilis and E. coli: compensating effects of changing zinc coordination and quaternary structure. Biochemistry 38(38):12258-65. Medline: 10493793.

Mejlhede N, Atkins JF, Neuhard J. 1999. Ribosomal -1 frameshifting during decoding of Bacillus subtilis cdd occurs at the sequence
CGA AAG. J Bacteriol 181(9):2930-7. Medline: 10217788.



Comment:
For statistical analysis of a deaminase domain, see Mian IS, Moser MJ, Holley WR, Chatterjee A. 1998. Statistical modelling and phylogenetic analysis of a deaminase domain. J Comput Biol 5(1):57-72. Medline: 9541871.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to cytidine deaminase sequences, e.g. residues 1-128 are 67% similar to CDD_MYCPN (P75051) from Mycoplasma pneumoniae. Residues 10-129 are 38% similar to CDD_MYCPI (L13289) from Mycoplasma pirum. Residues 3-128 are 34% similar to a cytidine/deoxycytidine deaminase from Thermotoga maritima (AAD35928.1). Residues 13-128 are 36% similar to a cytidine deaminase from Deinococcus radiodurans (AAF11726.1). Residues 16-105 are 43% similar to a cytidine deaminase from Caenorhabditis elegans (U64861). MG052 shows no significant similarities to T. pallidum and C. trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0295 is ehgp--y-.
COG name: Cytidine deaminase.
Functional Class: F
BeTs to e-g---y-.
Number of proteins in this genome belonging to this COG is 1.

Blocks Summary:  Blocks Search
Residues 18-25 are matched to block PR00406B, concerned with
cytochrome B5 reductase signature, e.g. NIA1_BRANA.
Residues 54-60, 78-95 are matched to blocks BL00903A,B,
(Cytidine and deoxycytidylate deaminases zinc-binding regions).

ProDom Summary:  Protein Domain Search
Residues 1-27, 28-74, 75-129 constitute defined domains
of CDD_MYCGE.
Residues 22-127 are 37% similar to a putative cytidine deaminase
domain of CDD_SCHPO.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 3 to 107 (E-value = 6e-28) place MG052 in the dCMP_cyt_deam family which is described as Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383)

PDB Hit:
gi|1065119|pdb|1CTT| Cytidine deaminase (Cda) (E.C.3.5.4.5) complexed with 3,4-Dihydrozebularine (Dhz).

Gene Protein Sequence:
MKVNLEWIIKQLQMIVKRAYTPFSNFKVACMIIANNQTFFGVNIENSSFP
VTLCAERSAIASMVTSGHRKIDYVFVYFNTKNKSNSPCGMCRQNLLEFSH
QKTKLFCIDNDSSYKQFSIDELLMNGFKKS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGGTGAATTTAGAGTGGATAATTAAACAGTTACAAATGATAGTTAA
AAGAGCATATACTCCCTTTTCTAACTTTAAAGTTGCATGTATGATTATTG
CTAACAACCAAACTTTTTTTGGAGTTAACATTGAAAATTCTTCCTTTCCA
GTAACTTTGTGTGCTGAAAGAAGCGCCATTGCTAGCATGGTTACAAGTGG
TCATAGGAAAATTGATTATGTTTTTGTTTACTTCAATACTAAAAATAAGA
GTAACTCACCCTGTGGAATGTGCAGACAAAACTTACTGGAATTTTCCCAT
CAAAAAACAAAGCTTTTTTGTATTGATAATGATAGTAGTTATAAACAATT
TTCCATTGATGAATTATTAATGAATGGTTTTAAAAAGAGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy