Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR37 IGR33 IGR38 IGR35 IGR36 IGR34 rpL33, - MG055.1 MG055 nusG, - MG054 ffh, - MG048 cdd, - MG052 deoD, - MG049 metK,metX, - MG047 deoA, - MG051 MG045 manB, - MG053 rpL33, - MG055.1 MG055 nusG, - MG054 ffh, - MG048 cdd, - MG052 deoD, - MG049 metK,metX, - MG047 deoA, - MG051 MG045 manB, - MG053 MG055 nusG, - MG054 ffh, - MG048 rpL33, - MG055.1 cdd, - MG052 deoD, - MG049 metK,metX, - MG047 deoA, - MG051 manB, - MG053 deoC, - MG050 gcp, - MG046 deoC, - MG050 gcp, - MG046 MG045
* Calculated from Protein Sequence

Gene ID: MG050

DNA Molecule Name:
1  

Genbank ID:
1045723

Gene Name:
deoC  

Definition:
deoxyribose-phosphate aldolase

Gene Start:
59083

Gene Stop:
59751

Gene Length:
669

Molecular Weight*:
24660

pI*:
8.60

Net Charge*:
6.58

EC:
4.1.2.4  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; General  

Pathway: pathway table
Carbohydrate Metabolism; Pentose phosphate cycle

Primary Evidence:
Tham,T.N., Ferris,S., Kovacic,R., Montagnier,L. and Blanchard,A. 1993. Identification of Mycoplasma pirum genes involved in the salvage pathways for nucleosides. J. Bacteriol. 175 (16): 5281-5285. Medline: 93352438.

Loechel S, Inamine JM, Hu PC. 1989. Nucleotide sequence of the deoC gene of Mycoplasma pneumoniae. Nucleic Acids Res 17(2):801. Medline: 2492658.

Comment:
Reaction:
2-DEOXY-D-RIBOSE 5-PHOSPHATE = D-GLYCERALDEHYDE 3-PHOSPHATE + ACETALDEHYDE.

See MG049, a predicted deoD sequence; and MG051, a predicted deoA sequence.

This protein was classified as belonging to the group of proteins involved in energy metabolism (http://www.tigr.org/~clyde/Mgengenes99.html).

Blast Summary:  PSI-Blast Search
MG050 is orthologously related to MP0091: residues 1-223 of MG050 are 82% similar to residues 1-223 of MP0091, a predicted deoxyribose-phosphate aldolase in M. pneumoniae. MG050 is also similar to predicted deoxyribose-phosphate aldolases from U. urealyticum (UU585), T. pallidum (TP0264), Mycoplasma pirum (1352232), and Mycoplasma hominis (1169269). It shows no significant similarities to C. trachomatis or C. pneumoniae.

Hits in gapped BLAST to deoxyribose-phosphate aldolase
sequences from Aquifex aeolicus (3913447), Bacillus subtilis (1075835 and 1706363), Deinococcus radiodurans (6458945), Haemophilus influenzae (1169268), among others.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0274 is ehgpc---.
COG name: Deoxyribose-phosphate aldolase.
Functional Class: F
BeTs to -hg-c---.

Blocks Summary:  Blocks Search
Residues 178-208 are matched to block BL00911G,
concerned with Dihydroorotate dehydrogenase proteins,
e.g. PYRD_BACCL.

ProDom Summary:  Protein Domain Search
Residues 6-55, 56-184 constitute defined domains of DEOC_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 3 to 213 (E-value = 1.4e-119) place MG050 in the DeoC family which is described as Deoxyribose-phosphate aldolase (PF01791)

PDB Hit:


Gene Protein Sequence:
MKLEYNRIIDSTLVKADTLPHEIDTLCADAHKYQFFAVCVNPSYVSYAKN
ILKNTAVQLCCVVGFPLGQTTQKQKVYEAKIAIKEGADEIDMVMNIAEFK
KRCACVITEIRAVKKVCGKRKLKVIIETALLTNDEIKDAVNVCIDGNADY
VKTSTGFSFRGASLEDVQIMNNAAANLIKIKASGGIKTAKQFIDLFQAGA
SRIGTSNAVQIMQELKKMNHEYH

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTAGAATACAACCGGATTATTGATAGCACCTTAGTCAAAGCTGA
TACGCTTCCCCATGAAATAGATACTTTATGTGCTGATGCTCATAAATACC
AGTTTTTTGCAGTGTGTGTTAATCCTAGTTATGTTAGTTATGCTAAAAAC
ATCTTGAAAAATACTGCAGTTCAACTCTGTTGTGTTGTTGGTTTCCCCTT
AGGACAAACAACCCAAAAACAGAAGGTATATGAAGCTAAGATTGCTATTA
AAGAGGGAGCGGATGAAATTGATATGGTAATGAATATTGCTGAGTTTAAA
AAACGTTGTGCTTGTGTTATTACTGAAATTAGAGCTGTTAAAAAAGTGTG
TGGCAAGCGTAAATTAAAAGTAATTATTGAAACTGCACTTTTAACAAATG
ATGAAATCAAAGATGCAGTTAATGTTTGCATTGATGGCAATGCAGATTAT
GTTAAAACTTCCACTGGTTTTTCTTTCCGTGGTGCATCTTTAGAAGATGT
TCAGATTATGAATAATGCTGCAGCAAATTTAATTAAAATCAAAGCTTCAG
GTGGGATTAAAACAGCAAAGCAATTTATAGATTTATTTCAAGCTGGAGCT
AGTAGAATTGGAACTTCAAATGCGGTCCAAATAATGCAAGAATTAAAAAA
AATGAACCATGAATATCAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy