Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR37 IGR33 IGR35 IGR36 IGR34 nusG, - MG054 ffh, - MG048 cdd, - MG052 deoD, - MG049 metK,metX, - MG047 deoA, - MG051 MG045 manB, - MG053 nusG, - MG054 ffh, - MG048 cdd, - MG052 deoD, - MG049 metK,metX, - MG047 deoA, - MG051 MG045 manB, - MG053 nusG, - MG054 ffh, - MG048 cdd, - MG052 deoD, - MG049 metK,metX, - MG047 deoA, - MG051 MG045 manB, - MG053 deoC, - MG050 gcp, - MG046 deoC, - MG050 gcp, - MG046
* Calculated from Protein Sequence

Gene ID: MG049

DNA Molecule Name:
1  

Genbank ID:
1045722

Gene Name:
deoD  

Definition:
purine nucleoside phosphorylase

Gene Start:
58117

Gene Stop:
59076

Gene Length:
960

Molecular Weight*:
35749

pI*:
8.59

Net Charge*:
4.97

EC:
2.4.2.1  2.7.-.-  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Nicotinate and nicotinamide metabolism
Purine metabolism
Pyrimidine metabolism

Primary Evidence:
Tham TN, Ferris S, Kovacic R, Montagnier L, Blanchard A. 1993. Identification of Mycoplasma pirum genes involved in the salvage pathways for nucleosides. J Bacteriol 175(16):5281-5. Medline: 8349569.

McElwain MC, Pollack JD. 1987. Synthesis of deoxyribomononucleotides in Mollicutes: dependence on
deoxyribose-1-phosphate and PPi. J Bacteriol 169(8):3647-53. Medline: 3038846.

O'Brien SJ, Simonson JM, Razin S, Barile MF. 1983. On the distribution and characteristics of isozyme expression in Mycoplasma, Acholeplasma, and Ureaplasma species. Yale J Biol Med 56(5-6):701-8. Medline: 6679151.

O'Brien SJ, Simonson JM, Grabowski MW, Barile MF. 1981. Analysis of multiple isoenzyme expression among twenty-two species of Mycoplasma and Acholeplasma. J Bacteriol 146(1):222-32. Medline: 7217001.

Secondary Evidence:
Bzowska A, Kazimierczuk Z, Seela F. 1998. 7-Deazapurine 2'-deoxyribofuranosides are noncleavable competitive inhibitors of Escherichia coli purine nucleoside phosphorylase (PNP). Acta Biochim Pol 45(3):755-68. Medline: 9918502.

Choi HS. 1998. Purification and partial characterization of purine
nucleoside phosphorylase from Serratia marcescens. Biosci Biotechnol Biochem 62(4):667-71. Medline: 9614697.

Hughes BW, King SA, Allan PW, Parker WB, Sorscher EJ. 1998. Cell to cell contact is not required for bystander cell killing by Escherichia coli purine nucleoside phosphorylase. J Biol Chem 273(4):2322-8. Medline: 9442077.

Mao C, Cook WJ, Zhou M, Koszalka GW, Krenitsky TA, Ealick SE. 1997. The crystal structure of Escherichia coli purine nucleoside phosphorylase: a comparison with the human enzyme reveals a conserved topology. Structure 5(10):1373-83. Medline: 9351810.

Parker WB, King SA, Allan PW, Bennett LL Jr, Secrist JA 3rd,
Montgomery JA, Gilbert KS, Waud WR, Wells AH, Gillespie GY, Sorscher EJ. 1997. In vivo gene therapy of cancer with E. coli purine nucleoside phosphorylase. Hum Gene Ther 8(14):1637-44. Medline: 9322865.



Comment:
This enzyme catalyzes the cleavage of guanosine or inosine to
respective bases and sugar-1-phosphate molecules.

See MG050, a predicted deoC sequence; and MG051, a predicted deoA sequence.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to purine nucleoside phosphorylase
sequences, e.g. residues 83-320 are 66% similar to DEOD_MYCPN from Mycoplasma pneumoniae. MG049 is also similar to T. pallidum TP0734, a predicted purine nucleoside phosphorylase (deoD), and to TP1027, a predicted uridine phosphorylase (udp). It shows no significant similarity to C. trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0813 is EHgp---u.
COG name: Purine-nucleoside (and uridine) phosphorylase.
Functional Class: F.
BeTs to e-g----u.
Number of proteins in this genome belonging to this COG is 1.

Blocks Summary:  Blocks Search
Residues 98-108, 139-151, 163-176, 234-244, 258-286 are matched to blocks
BL01232A-E, concerned with Purine and other phosphorylases
family 1 proteins, e.g. DEOD_ECOLI, DEOD_MYCGE.


ProDom Summary:  Protein Domain Search
Residues 1-94, 95-125, 126-191, 192-244, 245-267, 293-314
constitute defined domains of DEOD_MYCGE.
Residues 108-267 are 29% similar to a uridine phosphorylase
domain of UDP_MOUSE.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 96 to 316 (E-value = 4.9e-108) place MG049 in the PNP_UDP_1 family which is described as Phosphorylase family (PF01048)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
33  
52
transmembrane  
56  
75
non-globular  
242  
320

PDB Hit:
gi|1633413|pdb|1ECP|A Chain A, Purine Nucleoside Phosphorylase Pentosyltransferase, Purine Nucleoside Phosphorylase, Glycosyltransferase Mol_id: 1; Molecule: Purine Nucleoside Phosphorylase; Chain: A, B, C, D, E, F; Ec: 2.4.2.1; Engineered: Yes.

Gene Protein Sequence:
MVCPTVLSLIALMKFLTTSRLTSASSNAILISFRTNSTSFSVIVWALIFF
CIVRITMLDNIALNMIFNYLLLNNVLIKQYCNMTPHISAKKDDISKVVLM
PGDPLRAKWIAEQFLDQAKLVNEVRGMFAYTGQYKSKTVTVMGHGMGIPS
IGIYSYELMNFYEVETIIRIGSCGALAPQLKLKDLVIASKAWSESIYAKD
MGVEIPEDKILFATSSLVELAKETAIKNKLDFHEGLVFCEDAFYQTRKDV
ISLAKEKNSLAVEMEAHALYANAILLKKKALTLLTVSDSLVTHEALSSEL
RQKSFKQMALLALEMTQKLI

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTGTCCTACTGTTTTATCTCTAATTGCTTTGATGAAATTTTTAAC
AACAAGCAGGTTAACATCAGCATCAAGCAATGCAATTCTAATCTCTTTTA
GAACTAACTCTACATCTTTCTCAGTGATCGTTTGAGCGTTAATTTTTTTT
TGCATCGTGCGCATAACGATGCTTGATAACATTGCTTTGAACATGATTTT
TAATTATTTATTATTAAATAATGTTTTAATAAAACAATATTGCAATATGA
CCCCACATATAAGTGCTAAGAAAGATGACATTAGCAAAGTTGTTTTAATG
CCAGGTGATCCATTGAGAGCTAAATGGATAGCTGAGCAATTCTTAGATCA
AGCTAAATTAGTCAATGAAGTGAGGGGAATGTTTGCTTATACTGGGCAGT
ATAAATCTAAAACAGTTACAGTAATGGGCCATGGAATGGGGATCCCTTCT
ATTGGAATTTATTCATATGAGTTGATGAATTTTTATGAGGTTGAAACTAT
CATTAGAATCGGAAGTTGTGGTGCTTTAGCACCGCAATTAAAATTAAAAG
ATCTTGTTATTGCTTCAAAAGCATGAAGTGAGTCTATTTATGCTAAAGAC
ATGGGTGTTGAAATTCCAGAAGATAAGATCTTATTTGCAACAAGTTCTTT
AGTGGAATTAGCAAAAGAAACTGCGATTAAGAACAAGCTTGATTTTCATG
AAGGATTAGTATTTTGTGAGGATGCTTTTTATCAAACTAGAAAAGATGTA
ATTAGTCTTGCTAAAGAAAAAAATAGTTTAGCAGTTGAAATGGAAGCACA
TGCACTTTATGCTAATGCAATCCTGTTGAAGAAAAAAGCACTTACACTCT
TAACAGTATCTGATTCTCTAGTAACTCATGAAGCACTTAGTTCTGAATTA
AGACAAAAGTCATTTAAGCAAATGGCTTTATTAGCACTTGAAATGACTCA
AAAACTAATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy