Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR33 IGR35 IGR32 IGR34 ffh, - MG048 potB, - MG043 deoD, - MG049 metK,metX, - MG047 deoA, - MG051 MG045 potA, - MG042 ffh, - MG048 potB, - MG043 deoD, - MG049 metK,metX, - MG047 deoA, - MG051 MG045 potA, - MG042 ffh, - MG048 potB, - MG043 deoD, - MG049 metK,metX, - MG047 MG045 potA, - MG042 deoC, - MG050 potC, - MG044 gcp, - MG046 deoC, - MG050 potC, - MG044 gcp, - MG046 deoA, - MG051
* Calculated from Protein Sequence

Gene ID: MG046

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gcp  

Definition:
O-sialoglycoprotein endopeptidase

Gene Start:
54658

Gene Stop:
55602

Gene Length:
945

Molecular Weight*:
34694

pI*:
7.71

Net Charge*:
3.07

EC:
3.4.24.57  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous enzymes

Comment:
See Prosite PDOC00779.

From Prosite: Glycoprotease (GCP), or o-syaloglycoprotein endopeptidase, is a metalloprotease secreted by Pasteurella haemolytica which specifically cleaves O-sialoglycoproteins such as glycophorin A.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to sialoglycoprotease and its related sequences,
e.g. residues 1-315 are 72% similar to GCP_MYCPN.
MG046 is similar to T.pallidum TP0680, a predicted
sialoglycoprotease (gcp). It is also similar to C.trachomatis
o-sialoglycoprotein endopeptidase CT197 sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0533 is ehgpcmy.
COG name: Sialoglycoprotease.
Functional Class: M
BeTs to e,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 7-20, 43-54, 72-111, 132-141, 262-271, 152-182, 204-217
, 264-274, 293-303 are members of blocks BL01016A-H(Glycoprotease
family proteins).

ProDom Summary:  Protein Domain Search
Residues 7-40, 46-111, 112-174, 176-203, 204-315
constitute defined domains of GCP_MYCGE.
Residues 208-303 are 30% similar to a putative O-sialoglycoprotein
endopeptidase domain of GCP_HELPY.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 6 to 279 (E-value = 2.1e-128) place MG046 in the Peptidase_M22 family which is described as Glycoprotease family (PF00814)

PDB Hit:


Gene Protein Sequence:
MEQPLCVLGIETTCDDTGLSIVIDQKIKSNIVISSANLHVKTGGVVPEIA
ARCHEQNLFKAIRDLNFEIRDLSHIAYACNPGLAGCLHVGATFARSLSFL
LDKPLLPINHLYAHIFSCLIDQDLNKLQLPALGLVISGGHTAIYLVKSFY
ELELIAETSDDAIGEVYDKIGRAMGFDYPAGSKIDSLFNKELVKPHYFFK
PSTKWTKFSYSGLKSQCLNKIKQISANKTRIDWSELASNFQATIIDHYID
HVKNAIKKFAPKMLLVGGGVSANSYLSNRISTLNLPFLIADSKYTSDNGA
MIGFYASLLINGDKN

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACAACCGTTGTGTGTTTTAGGGATTGAAACAACCTGTGATGATAC
AGGTCTTAGTATTGTCATTGATCAAAAAATCAAGAGTAACATTGTTATCT
CTTCTGCTAACTTACATGTAAAAACAGGAGGAGTTGTACCTGAAATTGCA
GCACGATGCCACGAACAAAATCTCTTTAAAGCAATAAGAGATTTAAATTT
TGAGATAAGAGATTTATCTCACATTGCTTATGCATGTAATCCTGGGTTAG
CAGGATGTTTACATGTGGGAGCCACTTTTGCTAGAAGCTTAAGTTTCTTA
TTAGACAAACCATTGTTACCCATCAACCATCTTTATGCGCATATCTTTTC
TTGTTTAATTGATCAAGATTTAAATAAGCTGCAATTACCAGCATTAGGCC
TTGTAATTTCAGGTGGACATACTGCCATTTATCTAGTTAAATCATTTTAT
GAACTTGAACTAATTGCTGAAACTAGTGATGATGCAATTGGTGAAGTTTA
TGACAAGATAGGCAGAGCAATGGGCTTTGATTATCCTGCTGGTAGTAAAA
TTGATAGTCTTTTTAATAAAGAATTAGTTAAACCTCACTATTTCTTTAAA
CCTTCTACTAAGTGAACTAAGTTTTCCTATTCTGGTTTAAAATCTCAGTG
TTTAAACAAGATTAAACAAATAAGTGCTAATAAAACCCGAATTGATTGGA
GTGAATTAGCATCCAATTTTCAAGCTACTATTATTGATCATTACATTGAT
CATGTTAAAAATGCAATTAAAAAATTTGCCCCTAAAATGTTGTTAGTAGG
AGGTGGAGTTAGTGCCAATTCTTATCTATCTAACAGAATTAGTACATTAA
ATTTACCCTTTTTAATTGCTGATAGCAAATACACCAGTGATAATGGAGCA
ATGATTGGTTTTTATGCATCACTTTTAATTAATGGCGATAAGAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy