Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR28 IGR32 IGR30 IGR29 IGR31 glpK, - MG038 ptsH, - MG041 potB, - MG043 aspS, - MG036 potA, - MG042 MG040 glpK, - MG038 ptsH, - MG041 potB, - MG043 aspS, - MG036 potA, - MG042 MG040 glpK, - MG038 glpA, - MG039 glpA, - MG039 ptsH, - MG041 potB, - MG043 aspS, - MG036 potA, - MG042 MG040 pbeF, - MG037 pbeF, - MG037
* Calculated from Protein Sequence

Gene ID: MG039

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glpA  

Definition:
glycerol-3-phospate dehydrogenase

Gene Start:
47422

Gene Stop:
46271

Gene Length:
1152

Molecular Weight*:
42783

pI*:
10.00

Net Charge*:
10.59

EC:
1.1.99.5  

Functional Class:
Energy metabolism; Anaerobic  

Pathway: pathway table
Glycerolipid metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to glycerol-3-phosphate dehydrogenase subunit A
and hypothetical protein sequences, e.g. residues 5-363 are
24% similar to AE001012[Archaeoglobus fulgidus].
MG039 shows no significant similarity to C.trachomatis and
T.pallidum sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0579 is e-hgpc-y.
COG name: Predicted dehydrogenase.
Functional Class: R
BeTs to e,g,c.

Blocks Summary:  Blocks Search
Residues 5-24 are matched to block PR00757A, concerned with
flavin-containing amine oxidase signatures, e.g. S45812.
Residues 5-27 are matched to block PR00420A, concerned with
aromatic-ring hydroxylase signature, e.g. TCMG_STRGA.
Residues 5-56, 6-57, 332-357 are matched to blocks BL00977A,B,
concerned with FAD-dependent glycerol-3-phosphate dehydrogenase
proteins, e.g. GPDM_YEAST.
Residues 5-27, 6-20 are matched to blocks PR00419A,D, concerned with
adrenodoxin reductase family signature, e.g. GLSN_MEDSA.

ProDom Summary:  Protein Domain Search
Residues 21-45, 46-384 constitute defined domains of Y039_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MQTIDVLIVGGGVIGTSCAYELSQYKLKVALLEKNAFLGCETSQANSGVI
HSGIDPNPNKLTAKYNILGRKIWIEDWFKKLIFPRKKIATLIVAFNNEEK
LQLNLLKERGIKNSIPVENIQILDQQQTLLQEPFINPNVVASLKVEGSWL
IDPLIATKCLALASLQNNVAIYSNKKVTKIEIDSDDDFLVFINNETTPQF
KTKKLIDAAGHYADWLAETTQVDNFKQTTRKGQYLVLKNQNNLKINTIIF
MVPTIHGKGVVVAEMLDGNILVGPNAVEGIEKNKTRSIDLDSINQIKTIG
KKMVPSLQFENSIYSFAGSRAIDIETNDFVIRTAKSNPNFIILGGMKSPG
LTSSPAIAKRAVELLNLKLKKKINWNPNYNLSWI

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAACAATTGACGTTTTAATTGTGGGTGGGGGTGTCATCGGTACTAG
TTGTGCATATGAACTCAGCCAATATAAATTAAAAGTTGCACTTTTAGAAA
AAAATGCTTTTTTGGGTTGTGAAACTTCGCAGGCTAACAGTGGTGTAATC
CATTCAGGAATTGATCCTAATCCTAATAAGCTAACTGCCAAATACAACAT
CTTAGGGAGAAAAATCTGAATTGAGGATTGATTTAAAAAACTAATCTTCC
CAAGGAAAAAAATTGCTACTTTAATTGTTGCTTTCAACAATGAAGAAAAA
CTTCAATTAAATTTGTTAAAAGAAAGGGGAATTAAAAACTCAATTCCTGT
TGAAAACATTCAAATATTAGATCAACAACAAACTTTATTGCAAGAACCGT
TTATCAATCCAAATGTAGTAGCTAGTTTAAAAGTTGAAGGTAGTTGACTA
ATTGACCCTTTAATTGCAACCAAGTGTTTAGCCCTTGCTAGTTTACAAAA
CAATGTTGCCATCTACTCAAATAAAAAAGTTACAAAAATTGAAATAGATT
CTGATGATGATTTTTTAGTTTTTATTAACAATGAAACAACACCACAATTT
AAAACCAAAAAGTTAATTGATGCAGCTGGTCATTATGCAGATTGACTAGC
AGAAACTACACAAGTTGATAATTTTAAACAAACAACAAGAAAAGGACAAT
ATCTAGTTTTAAAAAATCAAAACAACCTTAAGATTAACACAATTATTTTT
ATGGTACCTACTATCCATGGTAAGGGAGTAGTTGTTGCTGAGATGTTAGA
TGGTAATATCCTTGTGGGACCTAATGCAGTTGAGGGAATTGAAAAAAACA
AAACTCGTTCCATAGATTTAGATTCAATTAACCAAATTAAAACTATTGGT
AAAAAAATGGTTCCTTCATTGCAATTTGAAAATAGTATTTATAGTTTTGC
AGGTTCAAGAGCTATTGATATTGAAACAAATGACTTTGTTATTAGAACAG
CAAAAAGCAATCCTAACTTTATCATCCTTGGTGGCATGAAATCCCCTGGT
TTAACATCAAGTCCTGCTATTGCTAAGAGAGCAGTTGAACTCCTTAATTT
AAAGTTAAAAAAGAAGATAAATTGAAATCCTAATTACAACTTATCATGGA
TC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy