Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR28 IGR30 IGR27 IGR29 IGR31 glpK, - MG038 ptsH, - MG041 aspS, - MG036 potA, - MG042 MG040 glpK, - MG038 ptsH, - MG041 aspS, - MG036 potA, - MG042 MG040 glpK, - MG038 glpA, - MG039 glpA, - MG039 ptsH, - MG041 aspS, - MG036 potA, - MG042 MG040 hisS, - MG035 pbeF, - MG037 hisS, - MG035 pbeF, - MG037
* Calculated from Protein Sequence

Gene ID: MG038

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glpK  

Definition:
glycerol kinase

Gene Start:
46277

Gene Stop:
44754

Gene Length:
1524

Molecular Weight*:
56891

pI*:
8.32

Net Charge*:
5.86

EC:
2.7.1.30  

Functional Class:
Central intermediary metabolism; Other  

Pathway: pathway table
Metabolism of Complex Lipids; Glycerolipid metabolism

Comment:
See Prosite PDOC00408.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST glycerol kinase (ATP:GLYCEROL
3-PHOSPHOTRANSFERASE) sequences, e.g. residues 1-508 are
74% similar to GLPK_MYCPN.
MG038 shows no significant similarity to C.trachomatis and
T.pallidum sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0554 is ehgpc-y.
COG name: Sugar kinases.
Functional Class: G
BeTs to h,g,c,y.

Blocks Summary:  Blocks Search
Residues 7-30, 98-111, 131-147, 354-376, 418-452 are members
of blocks BL00933A-E(FGGY family of carbohydrate kinases proteins).

ProDom Summary:  Protein Domain Search
Residues 411-504 are 60% similar to a glycerol kinase domain,
represented by GLPK_MYCPN. Residues 27-47, 60-404, 407-433,
434-459 support this assignment.
Residues 262-491 are 28% similar to a L-ribulokinase domain
represented by ARAB_BACSU.


Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 7 to 258 (E-value = 3.3e-90) place MG038 in the FGGY_N family which is described as FGGY family of carbohydrate kinases, N-terminal domain (PF00370)
Residues 261 to 487 (E-value = 4.5e-57) place MG038 in the FGGY_C family which is described as FGGY family of carbohydrate kinases, C-terminal domain (PF02782)

PDB Hit:
gi|442946|pdb|1GLA|G Chain G, Glycerol Kinase (E.C.2.7.1.30) Complex With Glycerol And The (Escherichia Coli) Glucose-Specific Factor Iii (Iii-Glc)

Gene Protein Sequence:
MDLKKQYIIALDEGTSSCRSIVFDHNLNQIAIAQNEFNTFFPNSGWVEQD
PLEIWSAQLATMQSAKNKAQIKSHEVIAVGITNQRETIVLWNKENGLPVY
NAIVWQDQRTAALCQKFNEDKLIQTKVKQKTGLPINPYFSATKIAWILKN
VPLAKKLMEQKKLLFGTIDSWLIWKLTNGKMHVTDVSNASRTLLFDIVKM
EWSKELCDLFEVPVSILPKVLSSNAYFGDIETNHWSSNAKGIVPIRAVLG
DQQAALFGQLCTEPGMVKNTYGTGCFVLMNIGDKPTLSKHNLLTTVAWQL
ENHPPVYALEGSVFVAGAAIKWLRDALKIIYSEKESDFYAELAKENEQNL
VFVPAFSGLGAPWWDASARGIILGIEASTKREHIVKASLESIAFQTNDLL
NAMASDLGYKITSIKADGGIVKSNYLMQFQADIADVIVSIPKNKETTAVG
VCFLAGLACGFWKDIHQLEKLTTLDKKFKSTMDPNIRKTKINSWHKAVER
ALKWKEID

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCTAAAAAAACAATACATTATTGCCTTAGATGAAGGTACTAGTTC
TTGTCGATCAATTGTTTTTGATCACAATCTTAACCAAATAGCAATAGCAC
AAAACGAATTTAACACTTTTTTTCCTAATAGTGGTTGAGTTGAACAAGAT
CCACTAGAAATTTGATCAGCCCAACTAGCTACCATGCAAAGTGCTAAAAA
TAAAGCACAAATCAAATCTCATGAAGTGATTGCAGTTGGTATTACCAATC
AAAGAGAAACAATAGTTTTATGAAATAAAGAAAATGGTTTGCCTGTTTAT
AATGCCATCGTTTGACAGGATCAAAGAACTGCAGCACTATGTCAAAAATT
CAATGAGGATAAGTTAATCCAAACCAAAGTAAAACAAAAAACTGGATTAC
CTATTAACCCCTATTTTAGTGCTACTAAGATAGCTTGAATCTTAAAAAAT
GTTCCTTTAGCAAAGAAACTAATGGAGCAAAAAAAGTTGTTATTTGGCAC
CATTGATAGCTGATTAATCTGAAAACTAACTAATGGAAAAATGCATGTTA
CAGATGTTTCAAATGCTTCAAGAACTCTTTTATTTGACATTGTCAAAATG
GAGTGATCCAAAGAGTTATGTGATTTATTTGAAGTACCAGTTTCAATCTT
ACCTAAAGTTCTGAGTTCCAATGCTTACTTTGGTGATATTGAAACTAATC
ACTGATCTAGTAATGCTAAAGGTATTGTACCAATTAGAGCAGTTTTAGGA
GACCAGCAAGCAGCTTTGTTTGGTCAACTCTGTACTGAACCTGGAATGGT
AAAAAATACCTATGGTACTGGATGTTTTGTACTCATGAACATTGGTGATA
AACCAACACTCTCAAAGCACAATCTGCTCACAACAGTAGCATGGCAACTA
GAAAATCATCCACCTGTATATGCATTGGAAGGTAGTGTGTTTGTAGCGGG
TGCGGCTATAAAATGGTTAAGGGATGCATTAAAAATTATCTATTCAGAAA
AGGAAAGTGATTTTTATGCAGAACTTGCAAAAGAAAATGAACAAAACCTA
GTTTTTGTACCAGCTTTCAGTGGACTTGGAGCTCCTTGATGAGATGCTAG
TGCTAGGGGTATTATCTTAGGAATTGAAGCAAGCACTAAAAGAGAGCACA
TAGTAAAAGCTAGCTTAGAGTCAATTGCTTTTCAAACTAATGATTTATTA
AATGCAATGGCAAGTGATCTAGGCTATAAGATTACTAGCATTAAAGCTGA
TGGGGGGATTGTTAAATCAAACTATTTAATGCAGTTTCAAGCTGATATTG
CAGATGTAATTGTTTCTATCCCTAAAAATAAAGAAACCACTGCAGTTGGT
GTTTGTTTTTTAGCTGGACTTGCTTGTGGATTTTGAAAAGACATTCATCA
ACTTGAAAAACTCACTACTCTTGATAAAAAGTTCAAAAGCACTATGGACC
CAAACATAAGAAAAACCAAAATTAACAGTTGACATAAAGCAGTTGAACGT
GCTTTAAAATGGAAAGAAATTGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy