Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR28 IGR27 IGR25 IGR26 tdk, - MG034 glpK, - MG038 polC,polC-1, - MG031 glpF, - MG033 aspS, - MG036 MG032 tdk, - MG034 glpK, - MG038 polC,polC-1, - MG031 glpF, - MG033 aspS, - MG036 MG032 tdk, - MG034 glpK, - MG038 polC,polC-1, - MG031 glpF, - MG033 aspS, - MG036 MG032 hisS, - MG035 pbeF, - MG037 hisS, - MG035 pbeF, - MG037
* Calculated from Protein Sequence

Gene ID: MG034

DNA Molecule Name:
1  

Genbank ID:
3844644

Gene Name:
tdk  

Definition:
thymidine kinase

Gene Start:
40514

Gene Stop:
39876

Gene Length:
639

Molecular Weight*:
24086

pI*:
8.91

Net Charge*:
5.96

EC:
2.7.1.21  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Primary Evidence:
Pollack JD, Williams MV, Banzon J, Jones MA, Harvey L, Tully JG. 1996. Comparative metabolism of Mesoplasma, Entomoplasma, Mycoplasma, and Acholeplasma. Int J Syst Bacteriol 46(4):885-90. Medline: 8863414.

Neale GA, Mitchell A, Finch LR. 1983. Enzymes of pyrimidine deoxyribonucleotide metabolism in Mycoplasma mycoides subsp.
mycoides. J Bacteriol 156(3):1001-5. Medline: 6139361.

Stock DA, Gentry GA. 1971. Thymidine metabolism in Mycoplasma hominis. J Gen Microbiol 65(1):105-7. Medline: 5089326.

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to many thymidine kinase sequences, e.g. residues 9-188 are 72% similar to KITH_MYCPN (2146663 or P75070). Residues 11-189 are 48% similar to a thymidine kinase from Bacillus subtilis (405819). Residues 13-189 are 42% similar to a thymidine kinase from Deinococcus radiodurans (gb|AAF11536.1). MG034 shows no significant similarity to C. trachomatis and T. pallidum sequences.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 15-47, 86-100, 107-161, 175-189 are matched to blocks
BL00603A,B,C,D, concerned with Thymidine kinase cellular-type
proteins, e.g. KITH_MYCGE.

ProDom Summary:  Protein Domain Search
Residues 21-189, 1-20, 11-102, 190-213 constitute defined domains
of KITH_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 13 to 189 (E-value = 1.6e-62) place MG034 in the TK family which is described as Thymidine kinase (PF00265)

PDB Hit:


Gene Protein Sequence:
MGKYQPSFQTKKGWTEVICGPMFSGKTEKLLHKIKRWKIAKISVVIFKPI
IDTRQTNIVKSRNGEYDQAITINSPFEIYDHLVDKNYQIVAIDEAQFFSN
EIIEVVTTLNEIGTNVIISGLDTDFRAEPFGCIPQLLAIADVVNKLDAIC
NVCGSLAQRTQRLVNKNTNDNLVLIGDAEAYEARCKLHHSFLTKKHVTVK
TKNFKEQVQGKTQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTAAATATCAACCATCTTTTCAAACCAAAAAGGGCTGAACTGAAGT
TATTTGTGGCCCAATGTTTTCTGGAAAAACAGAGAAATTACTTCACAAAA
TAAAACGGTGAAAGATAGCCAAAATTTCAGTTGTTATCTTCAAACCAATA
ATTGATACTAGACAAACTAATATTGTCAAATCACGCAACGGTGAATATGA
TCAAGCAATAACTATTAATTCTCCTTTTGAGATCTATGATCACTTAGTTG
ATAAAAACTATCAAATTGTTGCCATTGATGAAGCACAATTCTTTTCAAAT
GAGATTATAGAAGTTGTTACAACTCTCAATGAGATAGGAACAAATGTAAT
TATTTCTGGGCTTGATACTGATTTTAGAGCTGAGCCTTTTGGTTGTATTC
CCCAACTTTTAGCAATAGCTGATGTAGTTAATAAACTTGATGCTATTTGC
AATGTTTGTGGTAGTTTAGCACAACGAACCCAAAGACTAGTAAATAAAAA
TACTAATGATAACCTTGTCTTAATTGGTGATGCAGAAGCTTATGAAGCTA
GATGCAAACTGCACCACTCATTTTTAACTAAAAAGCACGTTACTGTTAAA
ACCAAAAACTTTAAAGAACAGGTGCAGGGGAAAACCCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy