Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR22 IGR19 IGR23 IGR21 IGR24 IGR20 IGR25 MG029 upp, - MG030 polC,polC-1, - MG031 efp, - MG026 MG028 fba, - MG023 MG025 gtp1, - MG024 MG032 MG029 upp, - MG030 polC,polC-1, - MG031 efp, - MG026 MG028 fba, - MG023 MG025 gtp1, - MG024 MG032 MG029 upp, - MG030 polC,polC-1, - MG031 efp, - MG026 MG028 fba, - MG023 MG025 gtp1, - MG024 MG032 MG027 MG027
* Calculated from Protein Sequence

Gene ID: MG030

DNA Molecule Name:
1  

Genbank ID:
3844640

Gene Name:
upp  

Definition:
uracil phosphoribosyltransferase

Gene Start:
32324

Gene Stop:
31707

Gene Length:
618

Molecular Weight*:
22926

pI*:
10.30

Net Charge*:
8.20

EC:
2.4.2.9  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Secondary Evidence:
Tu AH, Turnbough CL Jr. 1997. Regulation of upp expression in Escherichia coli by UTP-sensitive selection of transcriptional start sites coupled with UTP-dependent reiterative transcription. J Bacteriol 179(21):6665-73. Medline: 9352914.

Martinussen J, Hammer K. 1994. Cloning and characterization of upp, a gene encoding uracil phosphoribosyltransferase from Lactococcus lactis. J Bacteriol 176(21):6457-63. Medline: 7961396.

Andersen PS, Smith JM, Mygind B. 1992. Characterization of the upp gene encoding uracil phosphoribosyltransferase of Escherichia coli K12. Eur J Biochem 204(1):51-6. Medline: 1371255.

Vales LD, Chase JW, Murphy JB. 1979. Orientation of the guanine operon of Escherichia coli K-12 by utilizing strains containing guaB-xse and guaB-upp deletions. J Bacteriol 139(1):320-2. Medline: 222730.

Comment:
Uracil is converted to UMP primarily by uracil phosphoribosyltransferase, (UPRTase). In E.coli UPRTase catalyzes the Mg(2+) conversion of uracil and PRPP to UMP and PPi. The homotrimeric enzyme in E.coli is activated by GTP. In E.coli upp is the first of a bicistronic operon in which the second gene, uraA, encodes a cytoplasmic membrane protein required for uracil uptake. However, uraA does not seem to be contained in the U.urealyticum genome. Also, in E.coli the PRPP binding site is located at residues 123-138. In U.urealyticum, 13 of those 16 amino acid residues are either similar or identical.

The enzymatic pathway is:
UMP + pyrophosphate = uracil + 5-phospho-alpha-D-ribose 1-diphosphate.

According to Prosite, MG030 has two N-glycosylation sites (21-24, NTTT; 118-121, NISD) and two protein kinase C phosphorylation sites (89-91, SDK; 143-145, SIK).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to multiple uracil phosphoribosyltransferase
sequences, i.e., residues 29-206 are 79% similar to UPP_MYCPN (sp|P75081). MG030 is also similar to predicted uracil phosphoribosyltransferases from T. pallidum (TP0448), Thermotoga maritima (gb|AAD35803.1), Bacillus caldolyticus (X99545 or emb|CAA67884), among others. No significant similarity to
C. trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0035 is ehgpc-Y-.
COG name: Uracil phosphoribosyltransferase.
Functional Class: F
BeTs to e-g-c-y-.
Number of proteins in this genome belonging to this COG is 1.

Blocks Summary:  Blocks Search
Residues 97-117 are matched to block PR00628B, concerned with
insulin receptor substrate-1 PTB domain signature, e.g. IRS1_HUMAN. Residues 126-136 are matched to block BL00093C, concerned with N-4 cytosine-specific DNA methylases proteins, e.g. MTHZ_METTF.

ProDom Summary:  Protein Domain Search
Residues 15-135 constitute defined domain of UPP_MYCGE.
Residues 6-182, 136-171, 140-203 support this assignment, e.g.
UPP_SYNY3, UPP_MYCPN.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 16 to 177 (E-value = 2.1e-07) place MG030 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

PDB Hit:


Gene Protein Sequence:
VIKKVQHALILNELTKLRDKNTTTSQFRMALNQITSLLFFEATKQLPLAT
VEVETPFAKTKGYKLKNDIVLVPIMRAGLGMIDAIVRYSDKIRVGHLGIY
RQTQTTSVISYYKKMPENISDSHVIILDPMLATGTTLLTAIKSIKEDKPI
KISVIAIVAAPEGINKVEKMHPHVDIFLAAIDEKLNDNRYIIPGLGDAGD
RLFGTK

Gene Nucleotide Sequence:  Sequence Viewer
GTGATAAAAAAAGTTCAACATGCTTTAATCTTGAATGAATTGACAAAACT
GCGTGATAAAAATACAACAACCTCCCAGTTTCGCATGGCCTTGAATCAAA
TCACTTCATTACTCTTTTTTGAAGCAACTAAACAGCTACCACTAGCAACA
GTTGAAGTTGAAACTCCCTTTGCTAAAACAAAGGGCTACAAATTAAAAAA
TGACATTGTTCTTGTACCTATTATGCGTGCTGGACTTGGAATGATTGATG
CTATTGTTCGCTATTCAGATAAAATCAGAGTTGGTCATTTAGGAATCTAT
CGTCAAACCCAAACAACCAGTGTAATTTCATACTATAAAAAGATGCCTGA
AAACATCTCTGATTCACATGTTATTATTCTTGATCCTATGCTTGCTACTG
GAACTACATTGTTAACTGCTATTAAATCTATTAAAGAAGATAAACCTATC
AAAATTAGTGTTATTGCTATAGTAGCAGCACCTGAAGGAATTAATAAAGT
AGAAAAAATGCATCCTCATGTTGATATATTTCTTGCAGCAATTGATGAAA
AGTTAAATGACAATAGATACATAATCCCTGGTCTTGGTGATGCTGGGGAC
CGTTTATTTGGTACTAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy