Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR22 IGR16 IGR19 IGR23 IGR21 IGR18 IGR17 IGR15 IGR20 MG029 upp, - MG030 rpoE, - MG022 efp, - MG026 MG028 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 MG029 upp, - MG030 rpoE, - MG022 efp, - MG026 MG028 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 upp, - MG030 MG029 rpoE, - MG022 efp, - MG026 MG028 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 MG027 pip_1, - MG020 MG027 pip_1, - MG020
* Calculated from Protein Sequence

Gene ID: MG023

DNA Molecule Name:
1  

Genbank ID:
3844632

Gene Name:
fba  

Definition:
fructose-bisphosphate aldolase

Gene Start:
26478

Gene Stop:
27341

Gene Length:
864

Molecular Weight*:
31296

pI*:
7.42

Net Charge*:
1.41

EC:
4.1.2.13  

Functional Class:
Energy metabolism; Glycolysis and Gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannose metabolism
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Carbohydrate Metabolism; Pentose phosphate cycle
Energy Metabolism; Methane metabolism

Comment:
This enzyme is the sixth step in glycolysis.

For reviews on fructose-1,6-bisphosphate aldolase, see Perham R.N. 1990. The fructose-1,6-bisphosphate aldolases: same reaction, different enzymes. Biochem. Soc. Trans. 18:185-187. Medline: 2199259. and Marsh J.J., Lebherz H.G. 1992. Fructose-bisphosphate aldolases: an evolutionary history. Trends Biochem. Sci. 17:110-113. Medline: 1412694.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to fructose-bisphosphate aldolase
sequences, e.g. residues 1-288 are 77% similar to ALF_MYCPN (sp|P75089; MP0129). MG023 is also similar to predicted fructose-bisphosphate aldolases from T. pallidum TP0662 and U. urealyticum UU596. No significant similarities were found to C. trachomatis or C. pneumoniae sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0191 is Ehgpc-yu.
COG name: Hexose-biphosphate aldolases.
Functional Class: G
BeTs to e-g-c-yu.

Blocks Summary:  Blocks Search
Residues 12-271 represent 9 matches to blocks BL00602A,B,C,D,E,F,G,
concerned with Fructose-bisphosphate aldolase class-II proteins,
e.g. ALF_MYCGE.

ProDom Summary:  Protein Domain Search
Residues 7-275 constitute a defined domain of ALF_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 1 to 288 (E-value = 1e-160) place MG023 in the F_bP_aldolase family which is described as Fructose-bisphosphate aldolase class-II (PF01116)

PDB Hit:
gi|2392634|pdb|1ZEN| Class Ii Fructose-1,6-Bisphosphate Aldolase Lyase, Aldehyde, Glycolysis Mol_id: 1; Molecule: Class Ii Fructose-1,6-Bisphosphate Aldolase; Chain: Null; Ec: 4.1.2.13; Engineered: Yes

Gene Protein Sequence:
MLVNFKLMLQKAKLGKYAIPHININNYEWAKAVLTAANQANSPIIVSVSE
GALKYMSGYSVVIPLVKGLIESLSVKVPVTLHLDHGSYDACIQALQAGFS
SVMFDGSHLPFEENFNKSKKLIEIAQKTNASVELEVGTIGGEEDGVIGQG
ELANVDECKQIASLKPDALAAGIGNIHGIYPKNWKGLNFPLIETISKITN
LPLVLHGGSGILENDVKKAISLGICKLNINTECQLAFAHEIRKYIESNKD
LDLNKKGYDPRKLLKEPTQAIVDTCLEKIDLCGSRNKA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTGTTAACTTTAAATTGATGCTTCAAAAAGCAAAGCTAGGTAAATA
TGCAATCCCTCACATTAACATCAATAACTATGAATGGGCCAAAGCTGTTT
TAACAGCAGCAAATCAAGCTAATAGCCCAATTATTGTTTCAGTATCTGAA
GGTGCTTTAAAGTACATGTCTGGTTATAGTGTTGTTATCCCGCTTGTTAA
GGGTTTAATTGAATCACTAAGTGTTAAAGTACCAGTGACATTACATTTAG
ATCATGGTAGTTATGATGCATGTATCCAAGCATTACAGGCTGGATTTAGT
TCAGTAATGTTTGATGGTTCACATTTACCATTTGAAGAAAATTTCAATAA
ATCTAAAAAGTTAATAGAGATAGCACAAAAAACAAATGCTTCTGTTGAAC
TTGAAGTTGGTACTATTGGTGGAGAAGAAGATGGTGTTATAGGACAAGGT
GAGTTAGCTAATGTTGATGAATGTAAACAAATCGCTAGTTTAAAACCAGA
TGCTTTAGCAGCAGGAATTGGTAATATCCATGGTATCTATCCTAAGAATT
GAAAAGGATTAAACTTTCCTTTGATTGAAACAATATCAAAAATTACTAAC
TTACCCTTAGTTTTACATGGTGGCTCTGGAATCTTAGAAAATGATGTTAA
AAAAGCAATTAGTTTAGGGATTTGCAAACTAAATATTAATACTGAGTGTC
AATTAGCATTTGCACATGAAATTAGAAAATACATTGAATCAAATAAAGAC
TTGGATCTTAACAAAAAAGGTTATGATCCTAGAAAACTTTTAAAAGAACC
TACTCAAGCAATTGTTGATACTTGCTTGGAAAAGATTGATTTGTGTGGTT
CTAGAAATAAAGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy