Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR22 IGR16 IGR19 IGR21 IGR18 IGR17 IGR15 IGR20 MG029 rpoE, - MG022 efp, - MG026 MG028 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 MG029 rpoE, - MG022 efp, - MG026 MG028 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 MG029 rpoE, - MG022 efp, - MG026 MG028 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 MG027 pip_1, - MG020 MG027 pip_1, - MG020
* Calculated from Protein Sequence

Gene ID: MG022

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpoE  

Definition:
RNA polymerase

Gene Start:
26035

Gene Stop:
26469

Gene Length:
435

Molecular Weight*:
17041

pI*:
4.31

Net Charge*:
-12.75

EC:
2.7.7.6  

Functional Class:
Transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
See MG054, a predicted nusG sequence; MG141, a predicted nusA sequence; MG177, a predicted rpoA sequence; MG249, a predicted rpoD sequence; MG340, a predicted rpoC sequence; and MG341, a predicted rpoB sequence.

Blast Summary:  PSI-Blast Search
Only ortholog detected was to RPOE_MYCPN: residues 1-145
are 84% similar to this sequence.
No significant similarities to T.pallidum or C.trachomatis sequences.

COGS Summary:  COGS Search
NONE.

Blocks Summary:  Blocks Search
NONE.

ProDom Summary:  Protein Domain Search
Residues 1-145, 2-144 represent a PROBABLE DNA-DIRECTED RNA
POLYMERASE DELTA SUBUNIT domain from RPOE_MYCGE and RPOE_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 1 to 144 (E-value = 4.2e-77) place MG022 in the RNA_pol_delta family which is described as DNA-directed RNA polymerase delta subunit (PF05066)

PDB Hit:


Gene Protein Sequence:
MQLEYLNLISQAKVIAEKQFKANPFSFETIWKEVVKHFKISKQDEPSLIG
RFYQDFLEDPNFVYLGDRKWKLRDFMKFDEWNKISQSMFVTKEIFEEGYE
DLSNKKVEPEEGVGDFIMGNDGDDNETGSEIVQGLINDSFSEENQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATTAGAGTACCTCAATCTTATTTCTCAAGCTAAAGTTATTGCAGA
AAAACAATTTAAAGCTAACCCTTTTTCTTTTGAAACAATTTGAAAAGAAG
TAGTTAAACATTTCAAGATTTCAAAACAAGATGAACCAAGCTTAATTGGT
CGTTTTTATCAAGATTTTCTTGAGGATCCTAACTTTGTCTATTTAGGTGA
TAGAAAATGAAAACTTCGTGATTTTATGAAGTTTGATGAATGGAACAAGA
TATCACAATCTATGTTTGTTACAAAGGAGATTTTTGAAGAAGGTTATGAA
GATCTTTCCAATAAAAAAGTAGAACCTGAGGAAGGAGTTGGTGATTTCAT
TATGGGAAATGATGGTGATGACAATGAAACTGGCAGTGAAATAGTACAAG
GTTTAATTAATGATTCATTCAGTGAGGAAAATCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy