Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR16 IGR19 IGR21 IGR18 IGR17 IGR15 IGR20 IGR14 rpoE, - MG022 MG017 efp, - MG026 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 rpoE, - MG022 MG017 efp, - MG026 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 rpoE, - MG022 MG017 efp, - MG026 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 MG027 pip_1, - MG020 pip_1, - MG020 MG027
* Calculated from Protein Sequence

Gene ID: MG021

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
metS  

Definition:
methionyl-tRNA synthetase

Gene Start:
24467

Gene Stop:
26002

Gene Length:
1536

Molecular Weight*:
59997

pI*:
8.50

Net Charge*:
10.58

EC:
6.1.1.10  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Methionine metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis
Metabolism of Other Amino Acids; Selenoamino acid metabolism

Comment:
See Prosite PDOC00161.

From Prosite:

Aminoacyl-tRNA synthetases (EC 6.1.1.-) [1] are a group of enzymes which activate amino acids and transfer them to specific tRNA molecules as the first step in protein biosynthesis. In prokaryotic organisms there are at least twenty different types of aminoacyl-tRNA synthetases, one for each different amino acid. In eukaryotes there are generally two aminoacyl-tRNA synthetases for each different amino acid: one cytosolic form and a mitochondrial form. While all these enzymes have a common function, they are widely diverse in terms of subunit size and of quaternary structure.

A few years ago it was found [2] that several aminoacyl-tRNA synthetases share a region of similarity in their N-terminal section, in particular the consensus tetrapeptide His-Ile-Gly-His ('HIGH') is very well conserved. The 'HIGH' region has been shown [3] to be part of the adenylate binding site. The 'HIGH' signature has been found in the aminoacyl-tRNA synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan, and valine. These aminoacyl-tRNA synthetases are referred to as class-I synthetases [4,5,6] and seem to share the same tertiary structure based on a Rossmann fold.



Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to methionyl-tRNA synthetase sequences,
e.g. residues 1-512 are 70% similar to SYM_MYCPN.
MG021 is similar to T.pallidum TP0798 a predicted
methionyl-tRNA synthetase, it shows weak similarity to
TP0586 ,TP1035 and TP0452(isoleucyl, leucyl and valyl-tRNA
synthetases). It is also similar to C.trachomatis methionyl-tRNA
synthetase sequences CT032 and shows weak similarity to
CT209, CT019, CT302(isoleucyl, leucyl and valyl-tRNA synthetases).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0143 is ehgpcmy.
COG name: Methionyl-tRNA synthetase.
Functional Class: J
BeTs to e,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 11-21, 299-308 are matched to blocks BL00178A,B,
concerned with Aminoacyl-transfer RNA synthetases class-I
proteins, e.g. SYM_MYCGE.
Residues 82-100 are matched to block PR00231C, concerned with
GEMINIVIRUS AL3 COAT PROTEIN SIGNATURE, e.g. VAL3_TYLCV.

ProDom Summary:  Protein Domain Search
Residues 18-126, 170-191, 192-218, 219-235, 236-258, 269-283,
316-340, 352-431, 432-472, 486-512 constitute defined domains
of SYM_MYCGE.

Paralogs:  Local Blast Search
MG021 is weakly related to MG334, MG345, MG266(tRNA synthetases)
, e.g. residues 157-478 and 14-119 are 23% and 26% similar to
MG334.

Pfam Summary:  Pfam Search
Residues 2 to 341 (E-value = 1.1e-08) place MG021 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
454  
470

PDB Hit:


Gene Protein Sequence:
MKRCYITTPIYYASGKPHIGHAFTTILADVIKRFKIQNGYEAFLLVGSDE
HGNKIESKAKSLNLDPKTFVDINAQAFKLMWKTLNISFDHFIRTTDEIHK
QQVQKTFQDLYDKKLIYQSEWKGAYCVECEQNYFTFNKQTMLCEIGHNLS
LVQEPCWFISFSSTKNWIETTIGKNQLNIIPKSRASELKNNFINNGLNDL
ALTRKNVTWGIKVPFDPNQTIYVWFDALFSYITNLGFRNGDPNFIKWWNN
DNKEREVIHLISREITRFHCIYWPIFLHLLDIKLPTQFLSHGWIVDGEGR
KMSKSLNNVISPEQLIDQFGVDGTRYCLLKEMRLDKDNRCSVSILKEIYN
ADLANSFGNHVSRTFGMIKKYLNGKLEYQIITDNALQKIMILIDESIVQF
DHYFNSYEFYRAINLLLKIVFELSKLIDDFKPWELFKNQEFSLLKQLLFT
CVRCVQVCYVLLTPILVNTASKVFHLFNFADDACRKDQLRDATLLKKIII
SNSMEVLFKRVD

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCGTTGTTATATTACAACCCCTATCTACTACGCATCAGGTAAGCC
ACACATAGGTCATGCTTTTACCACTATTTTGGCGGATGTAATTAAGCGTT
TTAAAATCCAAAACGGATATGAGGCTTTTTTGCTTGTTGGCAGTGATGAA
CATGGCAATAAAATAGAAAGTAAAGCTAAAAGTTTAAATTTAGATCCTAA
AACATTTGTTGATATTAACGCTCAAGCTTTTAAGTTAATGTGAAAGACCC
TTAATATTAGTTTTGATCACTTTATTAGAACAACTGATGAAATCCATAAA
CAACAAGTTCAAAAAACATTTCAAGATTTATATGACAAAAAACTAATTTA
TCAAAGTGAATGAAAAGGGGCATATTGTGTTGAGTGTGAACAAAATTACT
TTACTTTTAATAAACAAACAATGTTATGTGAAATAGGTCATAATCTCAGT
CTTGTCCAAGAACCTTGCTGATTTATTTCTTTTTCTTCTACTAAAAATTG
AATTGAAACAACGATAGGAAAAAATCAACTTAACATTATTCCTAAATCAC
GTGCTTCTGAATTAAAAAATAACTTTATAAACAATGGTTTAAACGATTTA
GCATTAACAAGAAAAAATGTTACTTGAGGAATAAAAGTTCCTTTTGATCC
AAATCAAACAATCTATGTTTGGTTTGATGCATTGTTTTCTTATATCACCA
ATTTAGGATTTAGAAATGGTGATCCTAATTTTATAAAGTGATGAAATAAT
GACAATAAAGAAAGAGAAGTTATCCATCTTATATCACGTGAAATCACCAG
ATTTCACTGCATCTATTGACCGATTTTTCTACACTTACTTGATATTAAGT
TACCAACCCAATTTTTATCACATGGCTGGATAGTTGATGGTGAAGGGAGA
AAGATGTCAAAATCTTTAAACAACGTTATCTCTCCAGAACAATTAATTGA
TCAATTTGGTGTTGATGGTACAAGATATTGTTTATTAAAAGAGATGCGTT
TAGATAAAGATAATCGTTGTAGTGTTAGCATCTTAAAAGAGATTTATAAT
GCTGATCTTGCCAATAGTTTTGGAAACCATGTTTCACGTACTTTTGGCAT
GATTAAAAAGTATCTAAACGGCAAATTAGAATACCAAATTATTACTGATA
ATGCACTTCAAAAAATAATGATTTTAATAGATGAATCAATCGTTCAATTT
GATCATTACTTTAACAGTTATGAATTTTATAGAGCGATTAATCTACTTTT
AAAAATTGTTTTTGAATTAAGTAAATTAATTGATGATTTCAAACCATGAG
AATTGTTTAAAAATCAGGAATTCTCACTTTTAAAACAACTACTTTTTACT
TGTGTTAGGTGTGTGCAGGTATGCTATGTGTTGTTAACACCTATCTTAGT
AAATACTGCTTCAAAAGTTTTTCATTTATTTAATTTCGCTGATGATGCCT
GTAGAAAAGATCAATTAAGAGATGCAACTTTATTAAAAAAAATTATTATC
TCTAATTCAATGGAAGTTTTATTTAAAAGAGTAGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy