Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR16 IGR19 IGR18 IGR12 IGR17 IGR15 IGR13 IGR20 IGR14 rpoE, - MG022 MG016 MG017 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 MG015 rpoE, - MG022 MG016 MG017 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 MG015 rpoE, - MG022 MG017 fba, - MG023 MG025 gtp1, - MG024 dnaJ_2, - MG019 mot1, - MG018 metS, - MG021 MG015 pip_1, - MG020 pip_1, - MG020 MG016
* Calculated from Protein Sequence

Gene ID: MG020

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pip_1  

Definition:
proline iminopeptidase

Gene Start:
23541

Gene Stop:
24464

Gene Length:
924

Molecular Weight*:
35276

pI*:
7.23

Net Charge*:
0.93

EC:
3.4.11.5  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Amino Acid Metabolism; Arginine and proline metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to proline iminopeptidase and its related sequences,
e.g. residues 1-308 are 62% similar to PIP_MYCPN. No significant
similarities to T.pallidum or C.trachomatis sequences.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0596 is ehgpc-y.
COG name: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily).
Functional Class: R
BeTs to g,c.

Blocks Summary:  Blocks Search
Residues 55-70, 101-114, 115-128, 253-267 are matched to blocks
PR00111A,B,C,D, concerned with ALPHA/BETA HYDROLASE FOLD SIGNATURE
, e.g. DMPD_PSEPU.

ProDom Summary:  Protein Domain Search
Residues 32-113, 126-297 constitute defined domains
of PIP_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 56 to 306 (E-value = 5.2e-19) place MG020 in the Abhydrolase_1 family which is described as alpha/beta hydrolase fold (PF00561)

PDB Hit:


Gene Protein Sequence:
MNTKLNVKGYLNVGDNHQLYYWTQGNPNGKPVLYIHGGPGSGTDEGCLKY
FDLETTWIILLDQRGCGKSKTNDIFYENNTDKLVSDFEILRQKLNIKNWT
LFGGSWGSALALVYAIKHPQVVDKIFLRALFLAREKDWSEALMGLGKMFY
PYEHQRFMDSIPKAYQNSYEQIVNYCYDQFQNGDESTKEKLAKAWVDWES
TLLSPINKIHSTATDFKLVEKLALLECHYAVNKSFLDENFILDNISVLKN
KSIYLAHGRFDLICPLYQPLALKQAFPELQLYVTNNAGHSGSDANNLATI
KHLLKTYL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATACAAAACTTAATGTAAAAGGTTATCTAAATGTTGGTGATAACCA
TCAACTTTATTACTGAACACAAGGAAATCCTAATGGTAAACCGGTTTTGT
ATATCCATGGCGGACCTGGTTCTGGTACTGATGAAGGATGTTTAAAGTAT
TTTGATCTTGAAACAACTTGGATTATTTTATTAGATCAAAGAGGTTGTGG
TAAGAGTAAGACTAATGATATCTTTTATGAAAATAACACTGATAAATTAG
TTAGTGATTTTGAAATTTTACGTCAAAAATTAAACATTAAAAACTGAACA
CTCTTTGGTGGTAGTTGGGGTTCTGCACTTGCTTTAGTTTATGCAATTAA
ACACCCACAAGTAGTTGATAAGATCTTTTTAAGAGCACTTTTTTTAGCTA
GAGAAAAAGACTGATCTGAAGCTTTAATGGGATTAGGAAAAATGTTTTAT
CCTTATGAACACCAACGCTTTATGGATAGTATTCCTAAAGCTTATCAGAA
CAGTTATGAACAAATTGTTAACTACTGTTATGATCAATTTCAAAATGGTG
ATGAATCAACCAAAGAAAAACTTGCTAAAGCTTGGGTGGATTGAGAATCA
ACATTACTTTCACCTATTAACAAAATTCATTCAACAGCAACAGACTTTAA
ATTAGTTGAAAAACTAGCTTTATTGGAATGTCACTATGCAGTTAATAAAA
GTTTTTTGGATGAAAACTTCATTCTAGATAACATTAGTGTTCTTAAAAAT
AAAAGTATTTATTTGGCTCATGGTAGATTTGATCTGATCTGTCCTTTATA
TCAACCATTAGCATTAAAACAAGCATTCCCTGAATTACAACTTTATGTAA
CCAATAATGCTGGTCATAGTGGTAGTGATGCTAATAATTTAGCAACTATA
AAACACCTTTTAAAAACTTACCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy