Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-1 tRNA-Ile-1 IGR6 IGR5 IGR8 IGR12 IGR7 IGR11 IGR13 IGR9 IGR10 rimK, - MG012 folD, - MG013 MG011 MG016 dnaE_1, - MG010 holB,dnaH_1, - MG007 MG009 tdhF, - MG008 MG015 msbA, - MG014 rimK, - MG012 folD, - MG013 MG011 MG016 dnaE_1, - MG010 holB,dnaH_1, - MG007 MG009 tdhF, - MG008 MG015 msbA, - MG014 rimK, - MG012 folD, - MG013 MG011 MG016 dnaE_1, - MG010 holB,dnaH_1, - MG007 MG009 tdhF, - MG008 MG015 msbA, - MG014
* Calculated from Protein Sequence

Gene ID: MG013

DNA Molecule Name:
1  

Genbank ID:
3844625

Gene Name:
folD  

Definition:
5,10-methylenetetrahydrofolate dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase

Gene Start:
15217

Gene Stop:
14399

Gene Length:
819

Molecular Weight*:
30443

pI*:
8.93

Net Charge*:
6.92

EC:
1.5.1.15  1.5.1.5  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folate  

Pathway: pathway table
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate

Secondary Evidence:
D'Ari L, Rabinowitz JC. 1991. Purification, characterization, cloning, and amino acid sequence of the bifunctional enzyme 5,10-methylenetetrahydrofolate dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase from
Escherichia coli. J Biol Chem 266(35):23953-8. Medline: 1748668.

Dimri GP, Ames GF, D'Ari L, Rabinowitz JC. 1991. Physical map location of the Escherichia coli gene encoding the
bifunctional enzyme 5,10-methylene-tetrahydrofolate
dehydrogenase/5,10-methenyl-tetrahydrofolate cyclohydrolase. J Bacteriol 173(17):5251. Medline: 1885508.

Belanger C, Peri KG, MacKenzie RE. 1991. Analysis of the promoter region of the gene encoding NAD-dependent
methylenetetrahydrofolate dehydrogenase-methenyltetrahydrofolate
cyclohydrolase. Nucleic Acids Res 19(16):4341-5. Medline: 1843253.

Comment:
According to Prosite, this protein has one N-glycosylation site (81-84, NVTG) and two protein kinase C phosphotylation sites (15-17, TYK; 131-133, TLK).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to methylenetetrahydrofolate dehydrogenase
sequences, e.g. residues 1-267 are 65% similar to FOLD_MYCPN (sp|P75096). MG013 is similar to T. pallidum TP0732, a predicted
methylenetetrahydrofolate dehydrogenase sequence. It is also
similar to the C. trachomatis methylenetetrahydrofolate
dehydrogenase sequences CT078. MG013 is also similar to predicted methylenetetrahydrofolate dehydrogenasea from Bacillus subtilis (sp|P54382), Helicobacter pylori (sp|P56467), and Streptococcus thermophilus (sp|P96050), among others.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0190 is ehgpc-Yu.
COG name: 5,10-methylene-tetrahydrofolate dehydrogenase.
Functional Class: H
BeTs to e-g-c-yu.
Number of proteins in this genome belonging to this COG is 1.

Blocks Summary:  Blocks Search
Residues 24-259 represent 6 matches to blocks BL00766A-E
(Tetrahydrofolate dehydrogenase/cyclohydrolase proteins).
Residues 144-160 are matched to block BL00703C, concerned with
Orn/Lys/Arg decarboxylases family 1 pyridoxal-P attachment
site proteins, e.g. ADI_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 1-25, 26-257 constitute defined domains of FOLD_MYCGE.


Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 1 to 111 (E-value = 2.2e-46) place MG013 in the THF_DHG_CYH family which is described as Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain (PF00763)
Residues 113 to 266 (E-value = 4.1e-67) place MG013 in the THF_DHG_CYH_C family which is described as Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882)

PDB Hit:


Gene Protein Sequence:
MSFDGKLKAQSILETYKNFDWSKCKLVIIQANDDDSSDSFIKQKLIACNT
VGAKSELIKLSNQITQAELIEKIISLNHDVNVTGIILQLPVYPHLDKNSL
LEAINPLKDVDGLTTNHLAEIKPCIVEAIITLKELFNLEFNNQKIVVVGL
GITGGKPIYEFLKTSGYKVQACDKDTPNTFELIKSADIVFTAIGKSHFFQ
AKNFKKGVILFDIGVSRNKQNKLCGDINPEGIEKKARWWTKTPGGVGPFT
VLAIIKNLWILHEKNKRCLQSSI

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCATTTGATGGAAAACTAAAAGCGCAATCAATCTTAGAAACTTACAA
GAATTTTGATTGATCAAAATGTAAGTTAGTGATTATTCAAGCTAATGATG
ATGATTCATCAGACAGTTTTATTAAACAAAAACTTATTGCTTGTAACACT
GTAGGAGCAAAAAGTGAATTAATTAAACTATCTAATCAAATAACTCAAGC
AGAGTTAATAGAAAAAATAATTAGTTTAAATCATGATGTAAATGTTACTG
GTATCATTTTGCAATTGCCAGTTTATCCACACTTAGATAAAAACTCACTA
CTAGAAGCAATTAATCCTTTAAAAGATGTTGATGGTTTAACAACTAATCA
TTTGGCTGAAATTAAACCTTGTATAGTTGAAGCTATAATAACACTAAAAG
AACTATTTAACCTTGAATTTAATAATCAAAAAATTGTTGTGGTAGGTTTG
GGAATAACTGGTGGCAAACCTATTTATGAATTTTTAAAAACTAGTGGTTA
TAAAGTTCAAGCATGCGATAAAGATACTCCAAATACATTTGAATTGATTA
AAAGTGCTGATATAGTTTTTACTGCTATTGGAAAATCTCATTTTTTTCAA
GCTAAAAACTTTAAAAAAGGAGTTATTTTATTTGATATAGGTGTTTCAAG
AAACAAGCAAAATAAACTTTGTGGTGATATAAATCCTGAAGGCATTGAAA
AAAAAGCTAGATGATGAACTAAAACGCCTGGCGGTGTTGGCCCTTTTACA
GTTTTAGCAATAATAAAAAATCTTTGAATATTGCATGAAAAAAATAAACG
TTGTTTACAATCCAGCATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy