Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR6 IGR5 IGR4 IGR3 IGR7 MG011 dnaE_1, - MG010 holB,dnaH_1, - MG007 MG009 tdhF, - MG008 gyrB, - MG003 gyrA, - MG004 MG011 dnaE_1, - MG010 holB,dnaH_1, - MG007 MG009 tdhF, - MG008 gyrB, - MG003 gyrA, - MG004 Type: inverted, Name:  - 59 Type: inverted, Name:  - 59 Type: inverted, Name:  - 65 MG011 dnaE_1, - MG010 holB,dnaH_1, - MG007 MG009 tdhF, - MG008 gyrB, - MG003 gyrA, - MG004 tmk, - MG006 serS, - MG005 tmk, - MG006 serS, - MG005
* Calculated from Protein Sequence

Gene ID: MG005

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
serS  

Definition:
seryl-tRNA synthetase

Gene Start:
7295

Gene Stop:
8545

Gene Length:
1251

Molecular Weight*:
47975

pI*:
9.96

Net Charge*:
13.76

EC:
6.1.1.11  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Glycine, serine and threonine metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
See Prosite PDOC00363.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to seryl-tRNA synthetase sequences, e.g.
residues 1-416 are 79% similar to SYS_MYCPN.
MG005 is similar to T.pallidum TP0647, a predicted seryl-tRNA
synthetase.It is also similar to the C.trachomatis seryl-tRNA
synthetase sequences CT729.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0172 is ehgpcmy.
COG name: Seryl-tRNA synthetase.
Functional Class: J
BeTs to e,g,c,y.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-74, 75-99, 100-135, and 136-406 constitute defined domains
of SYS_MYCGE.

Paralogs:  Local Blast Search
MG005 is weakly related to MG298, 115 kDa protein. Residues
5-99 and 24-90 are 30% and 29% similar to MG298.

Pfam Summary:  Pfam Search
Residues 1 to 104 (E-value = 1.9e-22) place MG005 in the Seryl_tRNA_N family which is described as Seryl-tRNA synthetase N-terminal domain (PF02403)
Residues 158 to 311 (E-value = 8.5e-44) place MG005 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
45  
99

PDB Hit:
gi|494615|pdb|1SRY|A Chain A, Seryl-Trna Synthetase (E.C.6.1.1.11)

Gene Protein Sequence:
MLDPNKLRNNYDFFKKKLLERNVNEQLLNQFIQTDKLMRKNLQQLELANQ
KQSLLAKQVAKQKDNKKLLAESKELKQKIENLNNAYKDSQNISQDLLLNF
PNIAHESVPVGKNESANLELLKEGRKPVFDFKPLPHRELCEKLNLVAFDK
ATKISGTRFVAYTDKAAKLLRAITNLMIDLNKSKYQEWNLPVVINELSLR
STGQLPKFKDDVFKLENTRYYLSPTLEVQLINLHANEIFNEEDLPKYYTA
TGINFRQEAGSAGKQTKGTIRLHQFQKTELVKFCKPENAINELEAMVRDA
EQILKALKLPFRRLLLCTGDMGFSAEKTYDLEVWMAASNEYREVSSCSSC
GDFQARRAMIRYKDINNGKNSYVATLNGTALSIDRIFAAILENFQTKDGK
ILIPQALKKYLDFDTIK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGGATCCAAACAAATTACGCAATAACTATGATTTCTTTAAAAAGAA
ACTGTTAGAAAGAAATGTAAATGAGCAATTATTAAATCAGTTTATTCAAA
CTGATAAACTAATGCGCAAAAACTTGCAACAACTTGAACTTGCTAACCAA
AAACAAAGCTTGTTGGCAAAACAAGTTGCTAAGCAAAAAGATAATAAAAA
GCTATTAGCTGAATCAAAAGAACTTAAGCAGAAGATTGAAAACTTAAATA
ATGCTTATAAAGATTCACAAAACATTAGTCAAGATTTACTTCTAAATTTT
CCTAATATTGCTCATGAATCAGTTCCTGTTGGTAAAAATGAATCAGCAAA
CTTAGAACTTCTTAAAGAAGGGAGAAAACCAGTTTTTGATTTCAAACCTT
TACCACATCGAGAGTTATGTGAAAAGTTAAATTTAGTTGCTTTTGATAAA
GCTACTAAGATTAGTGGAACTAGGTTTGTTGCATATACAGATAAAGCAGC
TAAACTACTTAGAGCGATAACTAATCTAATGATTGACCTTAATAAAAGCA
AGTATCAAGAATGAAACCTGCCAGTTGTTATTAATGAATTAAGTTTAAGA
TCAACCGGACAACTACCTAAGTTTAAAGATGATGTTTTTAAACTAGAAAA
CACCCGTTATTATCTTTCTCCAACTTTAGAGGTACAACTTATCAATTTAC
ATGCTAATGAAATTTTTAATGAAGAAGATTTACCTAAATACTACACTGCA
ACAGGTATTAACTTTCGTCAAGAAGCGGGTAGTGCTGGTAAACAAACCAA
AGGAACTATTAGATTGCATCAGTTTCAAAAAACTGAGTTAGTTAAGTTTT
GTAAACCTGAAAATGCTATCAATGAATTGGAAGCAATGGTTAGAGATGCT
GAACAAATCTTAAAGGCACTTAAGTTACCTTTTAGAAGGTTATTGTTATG
TACTGGTGATATGGGCTTTAGTGCTGAAAAAACATATGATCTTGAAGTTT
GAATGGCAGCTAGCAATGAATATCGTGAAGTTTCTTCTTGTTCATCTTGT
GGTGATTTTCAAGCAAGAAGAGCTATGATTCGTTACAAAGATATTAACAA
CGGTAAAAACAGTTATGTTGCTACTTTAAATGGAACAGCATTATCTATTG
ATAGAATTTTTGCTGCAATTCTAGAAAATTTTCAAACAAAAGATGGCAAA
ATTCTTATCCCACAAGCATTAAAAAAATACCTTGATTTTGACACAATCAA
G


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy