Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR5 IGR4 IGR3 IGR2 holB,dnaH_1, - MG007 dnaN, - MG001 dnaJ_1, - MG002 tdhF, - MG008 gyrB, - MG003 gyrA, - MG004 holB,dnaH_1, - MG007 dnaN, - MG001 dnaJ_1, - MG002 tdhF, - MG008 gyrB, - MG003 gyrA, - MG004 Type: inverted, Name:  - 59 Type: inverted, Name:  - 59 Type: inverted, Name:  - 65 holB,dnaH_1, - MG007 dnaN, - MG001 dnaJ_1, - MG002 tdhF, - MG008 gyrB, - MG003 gyrA, - MG004 tmk, - MG006 serS, - MG005 tmk, - MG006 serS, - MG005
* Calculated from Protein Sequence

Gene ID: MG004

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrA  

Definition:
DNA gyrase subunit A (topoisomerase IV subunit A)

Gene Start:
4813

Gene Stop:
7320

Gene Length:
2508

Molecular Weight*:
93677

pI*:
7.86

Net Charge*:
4.23

EC:
5.99.1.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous enzymes

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to gyrase A sequences, e.g. residues 1-836 are
82% similar to GYRA_MYCPN.
MG004 is similar to T.pallidum TP0005, a predicted DNA gyrase A
sequence.It is also similar to the C.trachomatis gyrase A sequences
CT189 and CT660.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0188 is ehgpc-y.
COG name: DNA gyrase (topoisomerase II) A subunit.
Functional Class: L
BeTs to h,g,c,y.

Blocks Summary:  Blocks Search
Residues 456-472 and 3-19 are matched to block PR00511C, concerned with
TEKTIN SIGNATURE proteins, e.g. A46170.

ProDom Summary:  Protein Domain Search
Residues 1-20, 43-220, 221-408, 409-437, 438-502, 532-551, 637-656,
735-751, and 819-829 constitute defined domains of GYRA_MYCGE,
DNA GYRASE SUBUNIT A. In addition to M. genitalium there were hits
to GYRA_CAMFE.

Paralogs:  Local Blast Search
MG004 is paralogously related to MG204, also thought to be a
topoisomerase IV subunit A. Residues 32-702 are 33% similar to
residues 20-682 of MG204.

Pfam Summary:  Pfam Search
Residues 44 to 490 (E-value = 1.7e-288) place MG004 in the DNA_topoisoIV family which is described as DNA gyrase/topoisomerase IV, subunit A (PF00521)
Residues 514 to 563 (E-value = 1.6e-10) place MG004 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 564 to 616 (E-value = 5.7e-13) place MG004 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 619 to 666 (E-value = 1.3e-09) place MG004 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 667 to 716 (E-value = 1.2e-11) place MG004 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 717 to 767 (E-value = 3e-08) place MG004 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 768 to 817 (E-value = 3.8e-15) place MG004 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
245  
342
coil-coil  
442  
495
non-globular  
660  
793
coil-coil  
809  
836

PDB Hit:
gi|1633273|pdb|1BGW| Topoisomerase Residues 410 - 1202, Isomerase, Topoisomerase, Dna-Binding, Phosphorylated Nuclear Protein Mol_id: 1; Molecule: Topoisomerase; Chain: Null; Fragment: Residues 410 - 1202; Engineered: Yes

Gene Protein Sequence:
MAKQQDQVDKIRENLDNSTVKSISLANELERSFMEYAMSVIVARALPDAR
DGLKPVHRRVLYGAYIGGMHHDRPFKKSARIVGDVMSKFHPHGDMAIYDT
MSRMAQDFSLRYLLIDGHGNFGSIDGDRPAAQRYTEARLSKLAAELLKDI
DKDTVDFIANYDGEEKEPTVLPAAFPNLLANGSSGIAVGMSTSIPSHNLS
ELIAGLIMLIDNPQCTFQELLTVIKGPDFPTGANIIYTKGIESYFETGKG
NVVIRSKVEIEQLQTRSALVVTEIPYMVNKTTLIEKIVELVKAEEISGIA
DIRDESSREGIRLVIEVKRDTVPEVLLNQLFKSTRLQVRFPVNMLALVKG
APVLLNMKQALEVYLDHQIDVLVRKTKFVLNKQQERYHILSGLLIAALNI
DEVVAIIKKSANNQEAINTLNTKFKLDEIQAKAVLDMRLRSLSVLEVNKL
QTEQKELKDSIEFCKKVLADQKLQLKIIKEELQKINDQFGDERRSEILYD
ISEEIDDESLIKVENVVITMSTNGYLKRIGVDAYNLQHRGGVGVKGLTTY
VDDSISQLLVCSTHSDLLFFTDKGKVYRIRAHQIPYGFRTNKGIPAVNLI
KIEKDERICSLLSVNNYDDGYFFFCTKNGIVKRTSLNEFINILSNGKRAI
SFDDNDTLYSVIKTHGNDEIFIGSTNGFVVRFHENQLRVLSRTARGVFGI
SLNKGEFVNGLSTSSNGSLLLSVGQNGIGKLTSIDKYRLTKRNAKGVKTL
RVTDRTGPVVTTTTVFGNEDLLMISSAGKIVRTSLQELSEQGKNTSGVKL
IRLKDNERLERVTIFKEELEDKEMQLEDVGSKQITQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAAGCAACAAGATCAAGTAGATAAGATTCGTGAAAACTTAGACAA
TTCAACTGTCAAAAGTATTTCATTAGCAAATGAACTTGAGCGTTCATTCA
TGGAATATGCTATGTCAGTTATTGTTGCTCGTGCTTTACCTGATGCTAGA
GATGGACTTAAACCAGTTCATCGTCGTGTTCTTTATGGTGCTTATATTGG
TGGCATGCACCATGATCGTCCTTTTAAAAAGTCTGCGAGGATTGTTGGTG
ATGTAATGAGTAAATTCCACCCTCATGGTGATATGGCAATATATGACACC
ATGTCAAGAATGGCTCAAGACTTTTCATTAAGATACCTTTTAATTGATGG
TCATGGTAATTTTGGTTCTATAGATGGTGATAGACCTGCTGCACAACGTT
ATACAGAAGCAAGATTATCTAAACTTGCAGCAGAACTTTTAAAAGATATT
GATAAAGATACAGTTGACTTTATTGCTAATTATGATGGTGAGGAAAAAGA
ACCAACTGTTCTACCAGCAGCTTTCCCTAACTTACTTGCAAATGGTTCTA
GTGGGATTGCAGTTGGAATGTCAACATCTATTCCTTCCCATAATCTCTCT
GAATTAATTGCGGGTTTAATCATGTTAATTGATAATCCTCAATGCACTTT
TCAAGAATTATTAACTGTAATTAAAGGACCTGATTTTCCAACAGGAGCTA
ACATTATCTACACAAAAGGAATTGAAAGCTACTTTGAAACAGGTAAAGGC
AATGTAGTAATTCGTTCTAAAGTTGAGATAGAACAATTGCAAACAAGAAG
TGCATTAGTTGTAACTGAAATTCCTTACATGGTTAACAAAACTACCTTAA
TTGAAAAGATTGTAGAACTTGTTAAAGCTGAAGAGATTTCAGGAATTGCT
GATATCCGTGATGAATCCTCTCGAGAAGGAATAAGGTTAGTGATTGAAGT
AAAACGCGACACTGTACCTGAAGTTTTATTAAATCAACTTTTTAAATCAA
CAAGATTACAAGTACGCTTCCCTGTTAATATGCTTGCTTTAGTTAAAGGA
GCTCCTGTACTTCTCAACATGAAACAAGCTTTGGAAGTATATCTTGATCA
TCAAATTGATGTTCTTGTTAGAAAAACAAAGTTTGTGCTTAATAAACAAC
AAGAACGTTATCACATTTTAAGCGGACTTTTAATTGCTGCTTTAAATATT
GATGAGGTTGTTGCAATTATTAAAAAATCAGCAAATAACCAGGAAGCAAT
TAATACATTAAATACAAAGTTTAAGCTTGATGAAATTCAAGCTAAAGCAG
TTCTTGACATGCGTTTAAGGAGCTTAAGCGTACTTGAAGTTAACAAACTT
CAAACTGAACAAAAAGAGTTAAAAGATTCAATTGAATTTTGTAAGAAAGT
GTTAGCTGATCAAAAATTACAGCTAAAAATAATCAAAGAGGAATTGCAAA
AAATCAATGATCAGTTTGGTGATGAAAGAAGAAGTGAAATTCTCTATGAT
ATCTCTGAGGAAATTGATGATGAATCATTGATAAAAGTTGAGAATGTAGT
GATAACTATGTCTACAAATGGTTATCTAAAAAGGATTGGAGTTGATGCTT
ATAATCTTCAACATCGTGGTGGAGTTGGGGTTAAAGGGCTAACTACTTAT
GTTGATGATAGTATTAGTCAATTATTGGTCTGTTCAACTCACTCTGACTT
ATTATTTTTTACTGATAAGGGTAAGGTTTATAGAATTAGAGCTCATCAAA
TTCCCTATGGTTTTAGAACAAATAAAGGTATTCCCGCTGTTAACTTAATC
AAAATTGAAAAGGATGAAAGAATTTGTTCATTGTTATCTGTTAATAACTA
TGATGATGGTTATTTCTTTTTCTGTACTAAAAATGGAATTGTTAAAAGAA
CGAGCTTGAATGAATTCATCAACATCTTAAGTAATGGTAAGCGGGCTATA
TCTTTTGATGATAATGACACTTTGTATTCAGTAATTAAAACCCACGGAAA
TGATGAGATTTTTATTGGTTCTACCAATGGATTTGTTGTTCGCTTCCATG
AAAATCAACTCAGAGTTCTTTCAAGAACAGCAAGAGGTGTATTTGGTATC
AGTTTAAATAAAGGAGAATTTGTTAATGGACTATCAACTTCAAGCAACGG
TAGCTTACTTTTATCAGTCGGTCAAAATGGAATAGGTAAATTAACGAGCA
TAGATAAATATAGACTCACAAAACGTAATGCTAAGGGAGTTAAAACTCTA
AGGGTTACTGATAGAACAGGCCCTGTTGTTACAACAACCACTGTTTTTGG
TAATGAGGATCTTTTAATGATTTCCTCTGCTGGTAAAATTGTGCGTACCA
GTTTACAAGAACTTTCAGAACAAGGTAAAAACACTTCTGGTGTTAAGTTA
ATTAGATTAAAAGATAATGAACGTTTAGAAAGAGTAACTATCTTTAAAGA
AGAGTTAGAAGACAAAGAAATGCAACTAGAAGATGTTGGATCCAAACAAA
TTACGCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy