Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR4 IGR3 IGR350 IGR2 IGR349 IGR1 soj, - MG470 tmk, - MG006 dnaN, - MG001 dnaJ_1, - MG002 gyrB, - MG003 gyrA, - MG004 soj, - MG470 tmk, - MG006 dnaN, - MG001 dnaJ_1, - MG002 gyrB, - MG003 gyrA, - MG004 Type: inverted, Name:  - 59 Type: inverted, Name:  - 59 Type: inverted, Name:  - 65 soj, - MG470 dnaN, - MG001 dnaJ_1, - MG002 gyrB, - MG003 gyrA, - MG004 serS, - MG005 serS, - MG005 tmk, - MG006
* Calculated from Protein Sequence

Gene ID: MG003

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrB  

Definition:
DNA gyrase subunit B (DNA topoisomerase IV subunit B)

Gene Start:
2846

Gene Stop:
4795

Gene Length:
1950

Molecular Weight*:
73598

pI*:
6.25

Net Charge*:
-5.98

EC:
5.99.1.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous enzymes

Comment:
See Prosite PDOC00160.

From Prosite:

DNA topoisomerase I (EC 5.99.1.2) [1,2,3,4,E1] is one of the two types of enzyme that catalyze the interconversion of topological DNA isomers. Type II topoisomerases are ATP-dependent and act by passing a DNA segment through a transient double-strand break. Topoisomerase II is found in phages, archaebacteria, prokaryotes, eukaryotes, and in African Swine Fever virus (ASF). In bacteriophage T4 topoisomerase II consists of three subunits (the product of genes 39, 52 and 60). In prokaryotes and in archaebacteria the enzyme, known as DNA gyrase, consists of two subunits (genes gyrA and gyrB [E2]). In some bacteria, a second type II topoisomerase has been identified; it is known as topoisomerase IV and is required for chromosome segregation, it also consists of two subunits (genes parC and parE). In eukaryotes, type II topoisomerase is a homodimer.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to gyrase B sequences, e.g. residues 1-650 are 86% similar to
GYRB_MYCPN. MG003 is similar to T.pallidum TP1006, a predicted DNA gyrase B sequence.
It is also similar to the C.trachomatis gyrase B sequences CT190 and 0520.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0187 is ehgpc-y.
COG name: DNA gyrase (topoisomerase II) B subunit.
Functional Class: L
BeTs to h,g,c,y.

Blocks Summary:  Blocks Search
Residues 21-608 represent 9 matches to blocks BL00177A-H, DNA topoisomerase
II proteins.
In addition to hits to GYRB_MYCGE, it has hits to GYRB_BACSU.

ProDom Summary:  Protein Domain Search
Residues 271-497, 10-48, 49-186, 228-270, 506-573, 576-593, and
613-641 constitute defined domains of GYRB_MYCGE, DNA GYRASE SUBUNIT B.

Paralogs:  Local Blast Search
MG003 is paralogous to MG203, also thought to be a topoisomerase IV sequence: residues
10-647 are 45% similar to residues 5-633 of MG203.

Pfam Summary:  Pfam Search
Residues 35 to 180 (E-value = 9.8e-29) place MG003 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 228 to 408 (E-value = 4.3e-85) place MG003 in the DNA_gyraseB family which is described as DNA gyrase B (PF00204)
Residues 435 to 546 (E-value = 2e-05) place MG003 in the Toprim family which is described as Toprim domain (PF01751)
Residues 573 to 639 (E-value = 6.7e-46) place MG003 in the DNA_gyraseB_C family which is described as DNA gyrase B subunit, carboxyl terminus (PF00986)

PDB Hit:
gi|3212436|pdb|1AJ6| Novobiocin-Resistant Mutant (R136h) Of The N-Terminal 24 Kda Fragment Of Dna Gyrase B Complexed With Novobiocin At 2.3 Angstroms Resolution Topoisomerase, Gyrase, Novobiocin, Antibiotic, Resistant Mutant Mol_id: 1; Molecule: Gyrase;

Gene Protein Sequence:
MEENNKANIYDSSSIKVLEGLEAVRKRPGMYIGSTGEEGLHHMIWEIVDN
SIDEAMGGFASFVKLTLEDNFVTRVEDDGRGIPVDIHPKTNRSTVETVFT
VLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVFRQNKKYFLSFS
DGGKVIGDLVQEGNSEKEHGTIVEFVPDFSVMEKSDYKQTVIVSRLQQLA
FLNKGIRIDFVDNRKQNPQSFSWKYDGGLVEYIHHLNNEKEPLFNEVIAD
EKTETVKAVNRDENYTVKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVE
GFRNALVKIINRFAVENKFLKDSDEKINRDDVCEGLTAIISIKHPNPQYE
GQTKKKLGNTEVRPLVNSVVSEIFERFMLENPQEANAIIRKTLLAQEARR
RSQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAK
TGRDRYFQAILPLRGKILNVEKSNFEQIFNNAEISALVMAIGCGIKPDFE
LEKLRYSKIVIMTDADVDGAHIRTLLLTFFFRFMYPLVEQGNIFIAQPPL
YKVSYSHKDLYMHTDVQLEQWKSQNPNVKFGLQRYKGLGEMDALQLWETT
MDPKVRTLLKVTVEDASIADKAFSLLMGDEVPPRREFIEKNARSVKNIDI


Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGAAAATAACAAAGCAAATATCTATGACTCTAGTAGCATTAAGGT
CCTTGAAGGACTTGAGGCTGTTAGAAAACGCCCTGGAATGTACATTGGTT
CTACTGGCGAAGAAGGTTTGCATCACATGATCTGAGAGATAGTAGACAAC
TCAATTGATGAAGCAATGGGAGGTTTTGCCAGTTTTGTTAAGCTTACCCT
TGAAGATAATTTTGTTACCCGTGTAGAGGATGATGGAAGAGGGATACCTG
TTGATATCCATCCTAAGACTAATCGTTCTACAGTTGAAACAGTTTTTACA
GTTCTACACGCTGGCGGTAAATTTGATAACGATAGCTATAAAGTGTCAGG
TGGTTTACACGGTGTTGGTGCATCAGTTGTTAATGCGCTTAGTTCTTCTT
TTAAAGTTTGAGTTTTTCGTCAAAATAAAAAGTATTTTCTCAGCTTTAGC
GATGGAGGAAAGGTAATTGGAGATTTGGTCCAAGAAGGTAACTCTGAAAA
AGAGCATGGAACAATTGTTGAGTTTGTTCCTGATTTCTCTGTAATGGAAA
AGAGTGATTACAAACAAACTGTAATTGTAAGCAGACTCCAGCAATTAGCT
TTTTTAAACAAGGGAATAAGAATTGACTTTGTTGATAATCGTAAACAAAA
CCCACAGTCTTTTTCTTGAAAATATGATGGGGGATTGGTTGAATATATCC
ACCACCTAAACAACGAAAAAGAACCACTTTTTAATGAAGTTATTGCTGAT
GAAAAAACTGAAACTGTAAAAGCTGTTAATCGTGATGAAAACTACACAGT
AAAGGTTGAAGTTGCTTTTCAATATAACAAAACATACAACCAATCAATTT
TCAGTTTTTGTAACAACATTAATACTACAGAAGGTGGAACCCATGTGGAA
GGTTTTCGTAATGCACTTGTTAAGATCATTAATCGCTTTGCTGTTGAAAA
TAAATTCCTAAAAGATAGTGATGAAAAGATTAACCGTGATGATGTTTGTG
AAGGATTAACTGCTATTATTTCCATTAAACACCCAAACCCACAATATGAA
GGACAAACTAAAAAGAAGTTAGGTAATACTGAGGTAAGACCTTTAGTTAA
TAGTGTTGTTAGTGAAATCTTTGAACGCTTCATGTTAGAAAACCCACAAG
AAGCAAACGCTATCATCAGAAAAACACTTTTAGCTCAAGAAGCGAGAAGA
AGAAGTCAAGAGGCTAGGGAGTTAACTCGTCGTAAATCACCTTTTGATAG
TGGTTCATTACCAGGTAAATTAGCTGATTGTACAACCAGAGATCCTTCGA
TTAGTGAACTTTACATTGTTGAGGGTGATAGTGCTGGTGGCACTGCTAAA
ACAGGAAGAGATCGTTATTTTCAAGCTATCTTACCCTTAAGAGGAAAGAT
TTTAAACGTTGAAAAATCTAACTTTGAACAAATCTTTAATAATGCAGAAA
TTTCTGCATTAGTGATGGCAATAGGCTGTGGGATTAAACCTGATTTTGAA
CTTGAAAAACTTAGATATAGCAAGATTGTGATCATGACAGATGCTGATGT
TGATGGTGCACACATAAGAACACTTCTCTTAACTTTCTTTTTTCGCTTTA
TGTATCCTTTGGTTGAACAAGGCAATATTTTTATTGCTCAACCCCCACTT
TATAAAGTGTCATATTCCCATAAGGATTTATACATGCACACTGATGTTCA
ACTTGAACAGTGAAAAAGTCAAAACCCTAACGTAAAGTTTGGGTTACAAA
GATATAAAGGACTTGGAGAAATGGATGCATTGCAGCTGTGAGAAACAACA
ATGGATCCTAAGGTTAGAACATTGTTAAAAGTTACTGTTGAAGATGCTTC
TATTGCTGATAAAGCTTTTTCACTGTTGATGGGTGATGAAGTTCCCCCAA
GAAGAGAATTTATTGAAAAAAATGCTCGTAGTGTTAAAAACATTGATATT



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy