Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR3 IGR350 IGR2 IGR349 IGR1 soj, - MG470 MG468.1 dnaA, - MG469 dnaN, - MG001 dnaJ_1, - MG002 gyrB, - MG003 gyrA, - MG004 soj, - MG470 MG468.1 dnaA, - MG469 dnaN, - MG001 dnaJ_1, - MG002 gyrB, - MG003 gyrA, - MG004 Type: inverted, Name:  - 65 Type: inverted, Name:  - 59 Type: inverted, Name:  - 59 Type: inverted, Name:  - 63 Type: inverted, Name:  - 66 soj, - MG470 MG468.1 dnaA, - MG469 dnaN, - MG001 dnaJ_1, - MG002 gyrB, - MG003 gyrA, - MG004
* Calculated from Protein Sequence

Gene ID: MG001

DNA Molecule Name:
1  

Genbank ID:
3844620

Gene Name:
dnaN  

Definition:
DNA polymerase III beta subunit

Gene Start:
1026

Gene Stop:
1826

Gene Length:
801

Molecular Weight*:
31194

pI*:
4.78

Net Charge*:
-9.59

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
PolIII is a multichain enzyme with replicative function as well as 3' to 5' exonucleolytic activity. For other polIII subunits, see MG007, 031, 261, 420. For informatin on the alpha subunit, wee Koonin and Bork, TIBS 21:128-129 (1996).

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to DNA pol III beta sequences, e.g. residues
3-267 are 67% similar to DP3B_MYCPN. Residues 15-267 are 22% similar to DP3B_BACSU.
No similarities to T. pallidum or C. trachomatis beta subunits.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0592 is ehgpc--u.
COG name: DNA polymerase III beta subunit.
Functional Class: L
BeTs to -hg-c---.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 121-251, 1-120, 58-93 constitute defined domains
of DP3B_MYCGE. In addition, there are similarities to DP3B_MYCLE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 19 to 94 (E-value = 8.6e-12) place MG001 in the DNA_pol3_beta family which is described as DNA polymerase III beta subunit, N-terminal domain (PF00712)
Residues 145 to 267 (E-value = 1.5e-52) place MG001 in the DNA_pol3_beta_3 family which is described as DNA polymerase III beta subunit, C-terminal domain (PF02768)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
267

PDB Hit:


Gene Protein Sequence:
VNEFPRIRFNEKNDLSEFNQFKINYSLLVKGIKKIFHSVSNNREISSKFN
GVNFNGSNGKEIFLEASDTYKLSVFEIKQETEPFDFILESNLLSFINSFN
PEEDKSIVFYYRKDNKDSFSTEMLISMDNFMISYTSVNEKFPEVNYFFEF
EPETKIVVQKNELKDALQRIQTLAQNERTFLCDMQINSSELKIRAIVNNI
GNSLEEISCLKFEGYKLNISFNPSSLLDHIESFESNEINFDFQGNSKYFL
ITSKSEPELKQILVPSR

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATGAATTTCCAAGAATAAGGTTTAATGAAAAAAACGATTTAAGTGA
ATTTAATCAATTCAAAATAAATTATTCACTTTTAGTAAAAGGCATTAAAA
AAATTTTTCACTCAGTTTCAAATAATCGTGAAATATCTTCTAAATTTAAT
GGAGTAAATTTCAATGGATCCAATGGAAAAGAAATATTTTTAGAAGCTTC
TGACACTTATAAACTATCTGTTTTTGAGATAAAGCAAGAAACAGAACCAT
TTGATTTCATTTTGGAGAGTAATTTACTTAGTTTCATTAATTCTTTTAAT
CCTGAAGAAGATAAATCTATTGTTTTTTATTACAGAAAAGATAATAAAGA
TAGCTTTAGTACAGAAATGTTGATTTCAATGGATAACTTTATGATTAGTT
ACACATCGGTTAATGAAAAATTTCCAGAGGTAAACTACTTTTTTGAATTT
GAACCTGAAACTAAAATAGTTGTTCAAAAAAATGAATTAAAAGATGCACT
TCAAAGAATTCAAACTTTGGCTCAAAATGAAAGAACTTTTTTATGCGATA
TGCAAATTAACAGTTCTGAATTAAAAATAAGAGCTATTGTTAATAATATC
GGAAATTCTCTTGAGGAAATTTCTTGTCTTAAATTTGAAGGTTATAAACT
TAATATTTCTTTTAACCCAAGTTCTCTATTAGATCACATAGAGTCTTTTG
AATCAAATGAAATAAATTTTGATTTCCAAGGAAATAGTAAGTATTTTTTG
ATAACCTCTAAAAGTGAACCTGAACTTAAGCAAATATTGGTTCCTTCAAG
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy