Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR3 IGR1497 IGR1498 IGR1.1 IGR4 IGR1496 IGR1 IGR2 IGR1499 yckJ, - HD2033 yecC, - HD2032 yckK, - HD2035 HD2030 HD0003 HD2037 gidB, - HD0002 atpA, - HD0004 gidA, - HD0001 yckJ, - HD2033 yecC, - HD2032 yckK, - HD2035 HD2030 HD0003 HD2037 gidB, - HD0002 atpA, - HD0004 gidA, - HD0001 yckJ, - HD2033 yecC, - HD2032 yckK, - HD2035 HD2030 HD2034 HD2034 HD0003 HD2037 gidB, - HD0002 atpA, - HD0004 gidA, - HD0001
* Calculated from Protein Sequence

Gene ID: HD2037

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1698208

Gene Stop:
1698705

Gene Length:
498

Molecular Weight*:
18901

pI*:
10.50

Net Charge*:
13.18

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 22-165 are 36% similar to >15603408 unknown [Pasteurella multocida].

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 22-165 are 36% similar to a (PROTEOME COMPLETE PM1543) protein domain (PD400812) which is seen in Q9CKR3_PASMU.



Paralogs:  Local Blast Search
HD2037 is paralogously related to HD0805 (4e-31).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LAESYQNQKPRPNGFGFWLGNEQYKVNRYSSLPIYLTLKQNFKLNGHKKI
NLYVKGDLGYSFNKIKNTHYSLDTKFTNNAGIPELTSFPVEIKAKNGLYY
GLAVGAEYKNFLAEIGYYRTHANIVYSGTGKFKYPIDYINTHKHTINGKS
SYNNDAIRLSVGFKF$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGCAGAATCTTATCAAAACCAAAAACCTAGACCTAATGGTTTTGGTTT
TTGGTTAGGTAATGAACAATATAAAGTAAATCGTTATTCTTCATTACCGA
TCTACTTAACATTAAAACAAAACTTTAAGCTTAATGGGCATAAAAAGATA
AACCTTTATGTTAAAGGTGATCTTGGCTATTCCTTTAATAAAATTAAGAA
CACACATTATTCATTAGACACAAAATTTACGAATAATGCTGGAATACCTG
AATTAACCTCTTTCCCTGTCGAGATAAAAGCTAAAAATGGCTTATATTAT
GGTTTAGCGGTAGGTGCTGAATATAAGAATTTTTTAGCTGAAATCGGCTA
TTATAGAACCCATGCAAATATCGTTTATAGTGGAACAGGTAAATTCAAAT
ATCCTATAGATTACATAAACACCCACAAACATACAATTAATGGTAAATCC
TCTTATAACAATGATGCGATTCGTTTATCTGTTGGTTTCAAATTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy