Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1497 IGR1495 IGR1498 IGR1493 IGR1496 IGR1494 IGR1492 mscL, - HD2027 yckJ, - HD2033 yecC, - HD2032 yckK, - HD2035 trkH, - HD2028 HD2030 hgbA,hggB,hupA, - HD2025 fmt, - HD2029 mscL, - HD2027 yckJ, - HD2033 yecC, - HD2032 yckK, - HD2035 trkH, - HD2028 HD2030 hgbA,hggB,hupA, - HD2025 fmt, - HD2029 mscL, - HD2027 yckJ, - HD2033 yecC, - HD2032 yckK, - HD2035 trkH, - HD2028 HD2030 hgbA,hggB,hupA, - HD2025 HD2034 HD2034 fmt, - HD2029
* Calculated from Protein Sequence

Gene ID: HD2029

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fmt  

Definition:
methionyl-tRNA formyltransferase

Gene Start:
1691993

Gene Stop:
1692943

Gene Length:
951

Molecular Weight*:
34748

pI*:
9.40

Net Charge*:
5.12

EC:
2.1.2.9  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Methionine metabolism
One carbon pool by folate

Secondary Evidence:
Guillon,J.M., Mechulam,Y., Schmitter,J.M., Blanquet,S. and Fayat,G.
Disruption of the gene for Met-tRNA(fMet) formyltransferase
severely impairs growth of Escherichia coli
J. Bacteriol. 174 (13), 4294-4301 (1992)
Medline: 92325012

Meinnel,T., Guillon,J.M., Mechulam,Y. and Blanquet,S.
The Escherichia coli fmt gene, encoding methionyl-tRNA(fMet)
formyltransferase, escapes metabolic control
J. Bacteriol. 175 (4), 993-1000 (1993)
Medline: 93163064

Schmitt,E., Blanquet,S. and Mechulam,Y.
Structure of crystalline Escherichia coli methionyl-tRNA(f)Met
formyltransferase: comparison with glycinamide ribonucleotide
formyltransferase
EMBO J. 15 (17), 4749-4758 (1996)
Medline: 97042366


Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to methionyl tRNA formyltransferase from H. influenzae (1169712), E. coli (2914332, 120451, 606222), Pseudomonas aeruginosa (6016037), Vibrio alginolyticus (6016040), among others.

HD2029 is similar to methionyl tRNA formyltransferase from C. pneumoniae (CPn0649), C. trachomatis (CT530), T. pallidum (TP0756), U. urealyticum (UU463), M. pneumoniae (MP0299), and M. genitalium (MG365).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0223
COG name: Methionyl-tRNA formyltransferase
Functional Class: J
The phylogenetic pattern of COG0223 is ----yQvcEbRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001555 (Phosphoribosylglycinamide formyltransferase active site) with a combined E-value of 4.5e-07.
    IPB001555    107-119


ProDom Summary:  Protein Domain Search
Residues 28-168 are 81% similar to a (TRANSFERASE FORMYLTRANSFERASE PROTEOME COMPLETE) protein domain (PD001209) which is seen in FMT_HAEIN.

Residues 6-66 are 60% similar to a (FORMYLTRANSFERASE METHIONYL-TRNA) protein domain (PD106234) which is seen in Q9KVU4_VIBCH.

Residues 196-305 are 61% similar to a (FORMYLTRANSFERASE METHIONYL-TRNA) protein domain (PD004966) which is seen in FMT_HAEIN.

Residues 209-303 are 41% similar to a (METHIONYL-TRNA FORMYLTRANSFERASE) protein domain (PD404676) which is seen in FMT_BUCAI.

Residues 38-124 are 43% similar to a (PROTEASE 3.4.22.- PRTH THIOL) protein domain (PD116794) which is seen in PRTH_PORGI.

Residues 107-161 are 51% similar to a (CG1750) protein domain (PD387128) which is seen in Q9V9Z0_DROME.

Residues 67-167 are 43% similar to a (TRANSFERASE FORMYLTRANSFERASE) protein domain (PD396793) which is seen in Q9REQ1_ZYMMO.



Paralogs:  Local Blast Search


HD2029 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 183 (E-value = 4e-70) place HD2029 in the Formyl_trans_N family which is described as Formyl transferase (PF00551)
Residues 208 to 307 (E-value = 9.4e-38) place HD2029 in the Formyl_trans_C family which is described as Formyl transferase, C-terminal domain (PF02911)

PDB Hit:
pdb|2FMT|A Chain A, Methionyl-Trnafmet Formyltransferase Comple... 349 2e-097

Gene Protein Sequence:
MSKLNIIFAGTPEFAAQHLQALLASQHNIVAVYTQPDKPAGRGKKLQASP
VKQLALQHNIPVYQPKSLRNPQAQAELNALNGDVMVVVAYGLILPEAVLH
IPRYGCLNVHGSLLPRWRGAAPIQRAIWAGDQETGVTIMQMDAGLDTGDM
LHKVSTKIEADETSASLYMKLAKLAPPALLAVLDGLTEQQFKPEKQDNQL
ANYAEKLSKQEAKLDWNLPAYQLAQNIRAFNPWPMSFLTVEVEGVEQHVK
VYQATVLAHQYHAVGTVLQVDKNGIQIATSEGVLNITQLQPQGKKPMSVQ
DFLNGRANWFSLGKKL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAAATTAAATATTATTTTTGCAGGCACACCTGAATTTGCCGCACA
ACATTTACAAGCCTTATTAGCTTCTCAACACAATATCGTGGCGGTTTATA
CTCAACCGGATAAACCTGCAGGAAGAGGCAAAAAATTGCAAGCAAGCCCA
GTTAAACAACTTGCATTACAGCATAATATTCCTGTTTATCAGCCAAAATC
ATTGCGCAATCCGCAAGCACAAGCTGAGCTGAATGCATTAAATGGGGATG
TAATGGTTGTAGTTGCATACGGATTAATTCTCCCCGAAGCCGTTCTCCAT
ATTCCGCGTTATGGTTGTTTAAATGTACATGGTTCATTATTACCACGTTG
GCGCGGTGCAGCACCTATTCAGCGTGCGATTTGGGCGGGTGACCAGGAAA
CAGGAGTAACGATTATGCAAATGGATGCGGGCTTAGATACCGGCGATATG
TTACATAAAGTTAGCACAAAAATTGAAGCAGACGAAACCTCGGCTTCATT
ATATATGAAACTAGCCAAATTGGCACCGCCGGCATTATTAGCCGTCTTAG
ATGGGTTAACTGAACAGCAATTCAAACCTGAAAAACAAGACAATCAGTTA
GCCAACTATGCTGAAAAACTATCCAAACAAGAAGCAAAATTAGACTGGAA
TCTGCCCGCTTATCAGTTAGCACAAAATATACGTGCTTTTAATCCGTGGC
CAATGAGTTTTTTAACTGTTGAAGTAGAAGGGGTGGAACAACATGTGAAA
GTGTATCAAGCCACTGTATTAGCACATCAGTATCACGCTGTAGGCACGGT
ATTACAAGTAGATAAAAATGGAATTCAGATTGCGACAAGCGAAGGGGTTT
TAAATATTACTCAATTGCAACCACAAGGCAAAAAACCTATGTCGGTACAA
GATTTCTTAAACGGTAGAGCAAACTGGTTTAGTTTGGGTAAGAAATTATA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy