Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1483 IGR1479 IGR1478 IGR1484 IGR1482 IGR1486 IGR1480 IGR1485 IGR1481 IGR1487 HD2014 ybeD, - HD2015 HD2011 rlpA, - HD2017 lipB, - HD2013 lipA, - HD2012 pbp5,dacA, - HD2016 pbp2, - HD2020 purL, - HD2010 purL, - HD2008 purL, - HD2009 HD2014 ybeD, - HD2015 HD2011 rlpA, - HD2017 lipB, - HD2013 lipA, - HD2012 pbp5,dacA, - HD2016 pbp2, - HD2020 purL, - HD2010 purL, - HD2008 purL, - HD2009 ybeD, - HD2015 HD2011 rlpA, - HD2017 lipB, - HD2013 lipA, - HD2012 pbp5,dacA, - HD2016 pbp2, - HD2020 rodA,mrdB, - HD2019 rodA,mrdB, - HD2019 HD2014 purL, - HD2010 purL, - HD2008 purL, - HD2009
* Calculated from Protein Sequence

Gene ID: HD2013

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lipB  

Definition:
lipoate biosynthesis protein B

Gene Start:
1677339

Gene Stop:
1676665

Gene Length:
675

Molecular Weight*:
25183

pI*:
6.80

Net Charge*:
-0.88

EC:
6.3.4.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Lipoate  

Pathway: pathway table

Secondary Evidence:
Jordan SW, Cronan JE Jr.
A new metabolic link. The acyl carrier protein of lipid synthesis donates lipoic acid to the pyruvate dehydrogenase complex in Escherichia coli and mitochondria.
J Biol Chem. 1997 Jul 18;272(29):17903-6.
PMID: 9218413

Morris TW, Reed KE, Cronan JE Jr.
Lipoic acid metabolism in Escherichia coli: the lplA and lipB genes define redundant pathways for ligation of lipoyl groups to apoprotein.
J Bacteriol. 1995 Jan;177(1):1-10.
PMID: 8002607

Comment:
For the 'lipA' protein, see HD2012.

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to lipoate-protein lipase B from H. influenzae (1074973, 1170791), E. coli (421120, 2507595), Pseudomonas aeruginosa (6685618), Neisseria meningitidis (7226455), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0321
COG name: Lipoate-protein ligase B
Functional Class: H
The phylogenetic pattern of COG0321 is ----y--ce-rh--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000544 (Lipoate-protein ligase B) with a combined E-value of 8.4e-50.
    IPB000544A    34-52
    IPB000544B    69-84
    IPB000544C    138-173


ProDom Summary:  Protein Domain Search
Residues 10-131 are 71% similar to a (LIGASE LIPOATE-PROTEIN 6.-.-.-) protein domain (PD006086) which is seen in LIPB_PASMU.

Residues 132-186 are 70% similar to a (LIGASE LIPOATE-PROTEIN 6.-.-.-) protein domain (PD006665) which is seen in LIPB_PSEAE.

Residues 65-209 are 25% similar to a (B LIGASE LIPOATE-PROTEIN PEPTIDE) protein domain (PD254439) which is seen in LIPB_KLULA.

Residues 4-173 are 30% similar to a (B LIGASE LIPOATE-PROTEIN CHLOROPLAST) protein domain (PD070698) which is seen in LIPB_CYACA.



Paralogs:  Local Blast Search
HD2013 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 47 to 165 (E-value = 6.3e-28) place HD2013 in the BPL_LipA_LipB family which is described as Biotin/lipoate A/B protein ligase family (PF03099)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNHLIIRQLGIQPYERIWHQMQDFTDQRDEHSADEIWLVQHPAVFTQGSA
GKSEHLLTSSHIPVVQTDRGGQITYHGEGQQIMYVLIDIKRLKAQGKDIS
VRELVTALEQCVVRTLEDYGIDGYPKPDAPGVYIEGKKICSLGLRIRKGC
SFHGLAFNVNMDLTPFSHINPCGYAGLEMTQLKDYISEDNAQCKLVASKL
VAHFCNILGYNSQKITNKSEIQAV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCATTTAATTATCCGCCAACTTGGAATACAACCTTATGAGAGAAT
CTGGCATCAAATGCAAGATTTTACTGATCAGCGTGATGAACATAGTGCTG
ATGAGATTTGGCTTGTTCAGCATCCAGCTGTATTTACACAAGGTTCAGCG
GGTAAATCTGAGCATTTGCTTACTTCAAGCCATATTCCTGTCGTGCAGAC
CGATCGGGGCGGGCAAATAACCTATCATGGAGAAGGTCAGCAAATAATGT
ATGTGTTGATTGATATTAAACGTCTCAAAGCGCAAGGCAAAGATATTTCA
GTCAGAGAATTAGTCACCGCTTTAGAACAATGTGTGGTCAGAACGTTGGA
AGATTATGGTATTGATGGATATCCAAAACCTGATGCACCTGGGGTTTATA
TTGAGGGGAAAAAAATTTGTTCATTAGGGTTACGTATTCGTAAAGGGTGT
TCATTTCATGGGTTAGCCTTTAACGTCAATATGGATTTAACGCCGTTCAG
TCATATTAACCCTTGTGGTTATGCGGGCTTAGAAATGACCCAACTAAAAG
ATTATATCAGTGAAGATAATGCTCAATGTAAATTGGTTGCTTCAAAATTA
GTTGCTCACTTTTGCAACATTTTGGGATATAATAGCCAAAAAATTACTAA
TAAATCAGAAATTCAAGCCGTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy