Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1483 IGR1479 IGR1478 IGR1484 IGR1482 IGR1486 IGR1480 IGR1485 IGR1481 IGR1487 HD2014 ybeD, - HD2015 HD2011 rlpA, - HD2017 lipB, - HD2013 lipA, - HD2012 pbp5,dacA, - HD2016 pbp2, - HD2020 purL, - HD2010 purL, - HD2008 purL, - HD2009 HD2014 ybeD, - HD2015 HD2011 rlpA, - HD2017 lipB, - HD2013 lipA, - HD2012 pbp5,dacA, - HD2016 pbp2, - HD2020 purL, - HD2010 purL, - HD2008 purL, - HD2009 ybeD, - HD2015 HD2011 rlpA, - HD2017 lipB, - HD2013 lipA, - HD2012 pbp5,dacA, - HD2016 rodA,mrdB, - HD2019 pbp2, - HD2020 HD2014 rodA,mrdB, - HD2019 purL, - HD2010 purL, - HD2008 purL, - HD2009
* Calculated from Protein Sequence

Gene ID: HD2012

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lipA  

Definition:
lipoate biosynthesis protein A

Gene Start:
1676571

Gene Stop:
1675579

Gene Length:
993

Molecular Weight*:
37500

pI*:
8.30

Net Charge*:
6.53

EC:
2.8.1.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Lipoate  

Pathway: pathway table

Secondary Evidence:
Jordan SW, Cronan JE Jr.
A new metabolic link. The acyl carrier protein of lipid synthesis donates lipoic acid to the pyruvate dehydrogenase complex in Escherichia coli and mitochondria.
J Biol Chem. 1997 Jul 18;272(29):17903-6.
PMID: 9218413

Morris TW, Reed KE, Cronan JE Jr.
Lipoic acid metabolism in Escherichia coli: the lplA and lipB genes define redundant pathways for ligation of lipoyl groups to apoprotein.
J Bacteriol. 1995 Jan;177(1):1-10.
PMID: 8002607

Comment:
For the 'lipB' protein, see HD2013.

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to lipoic acid synthetase from H. influenzae (1170789), E. coli (2507056, 421119, 146617), Neisseria meningitidis (7226454, 7380046), among others.

HD2012 is similar to lipoate synthetase from C. trachomatis (CT558) and C. Pneumoniae (CPn0832). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0320
COG name: Lipoate synthase
Functional Class:  H
The phylogenetic pattern of COG0320 is ----yq-Cebrh------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003698 (Lipoate synthase) with a combined E-value of 1.9e-151.
    IPB003698A    45-55
    IPB003698B    75-112
    IPB003698C    124-166
    IPB003698D    174-183
    IPB003698E    197-215
    IPB003698F    239-288
    IPB003698G    290-320


ProDom Summary:  Protein Domain Search
Residues 14-158 are 90% similar to a (LIPOIC ACID SYNTHETASE LIPOATE) protein domain (PD005028) which is seen in LIPA_PASMU.

Residues 202-249 are 62% similar to a (LIP-SYN LIPOIC IRON-SULFUR LIPOATE) protein domain (PD402722) which is seen in LIPA_BUCAI.

Residues 162-201 are 72% similar to a (LIP-SYN LIPOIC IRON-SULFUR LIPOATE) protein domain (PD405503) which is seen in LIPA_PASMU.

Residues 281-328 are 77% similar to a (LIPOIC ACID SYNTHETASE LIPOATE) protein domain (PD186201) which is seen in LIPA_HAEIN.

Residues 202-253 are 88% similar to a (LIPOIC ACID SYNTHETASE LIPOATE) protein domain (PD223537) which is seen in LIPA_PASMU.

Residues 124-199 are 44% similar to a (LIPOIC PRECURSOR SYNTHETASE ACID) protein domain (PD390195) which is seen in Q9X6X1_MYXXA.

Residues 163-201 are 71% similar to a (PROTEOME COMPLETE SYNTHETASE LIPOATE) protein domain (PD403789) which is seen in Q9KTF9_VIBCH.

Residues 203-278 are 49% similar to a (LIPOIC SYNTHASE ACID COMPLETE) protein domain (PD406979) which is seen in LIPA_DEIRA.

Residues 162-253 are 77% similar to a (BIOTIN SYNTHASE SYNTHETASE IRON-SULFUR) protein domain (PD003026) which is seen in LIPA_HAEIN.



Paralogs:  Local Blast Search
HD2012 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 97 to 261 (E-value = 4.4e-23) place HD2012 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTTAIGKKTTKLEPFKMERGVKYRDAAKTSVIQVRNIDPDQELLKKPEWM
KIKLPTNSAKIDSIKYGMRRHGLHSVCEEASCPNLHECFNHGTATFMIMG
AICTRRCPFCDVAHGKPLPLDPYEPRKVAETVQDMKLKYVVITSVDRDDL
ADRGAAHFAATVREIKALNPECKVEILVPDFRGRVEQAVAILKQNPPDVF
NHNLENVPRLYREIRPGADYKWSLELLKIFKQEFPNIPTKSGLMVGLGET
NEEILAVMQDLRDHGVTMLTVGQYLQPSRHHLRVERYVPPAEFEMFRSEA
EKMGFEHAACGPFVRSSYHADLQAKGELVK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACAGCAATCGGTAAAAAAACAACTAAATTAGAACCATTTAAAAT
GGAACGCGGTGTAAAATATCGTGATGCGGCAAAGACTTCAGTGATTCAAG
TCAGGAATATTGACCCAGACCAAGAATTATTGAAAAAACCTGAGTGGATG
AAAATCAAGTTACCGACTAATTCAGCGAAAATTGATAGCATTAAATATGG
TATGCGTCGCCACGGGTTACATTCAGTTTGTGAAGAAGCATCTTGTCCAA
ATTTACATGAATGTTTTAATCATGGTACTGCCACTTTTATGATTATGGGC
GCAATTTGTACTCGTCGTTGTCCGTTTTGTGATGTTGCGCATGGTAAGCC
ATTACCACTTGATCCCTATGAACCGCGTAAAGTTGCCGAAACAGTGCAAG
ATATGAAATTAAAATACGTGGTAATTACGTCGGTCGATCGTGATGATTTG
GCCGATCGGGGGGCAGCACATTTTGCGGCTACAGTGCGAGAAATTAAAGC
ATTAAATCCTGAATGCAAAGTCGAGATTTTAGTCCCGGATTTTCGTGGTC
GAGTAGAACAAGCGGTTGCTATTTTGAAACAAAATCCACCCGATGTATTT
AATCATAATTTAGAAAATGTGCCACGTTTATATCGCGAAATTCGCCCGGG
AGCGGATTATAAATGGTCATTAGAATTGCTTAAAATTTTCAAACAAGAGT
TCCCTAATATTCCCACTAAATCAGGCTTAATGGTTGGATTGGGCGAAACA
AACGAAGAAATTTTAGCGGTTATGCAAGATTTACGTGATCATGGTGTGAC
GATGTTGACCGTTGGTCAATATTTACAACCAAGCCGTCATCACTTAAGAG
TAGAACGTTATGTTCCGCCTGCTGAATTTGAAATGTTTCGCAGTGAAGCT
GAAAAAATGGGATTTGAACACGCTGCTTGCGGTCCATTTGTTCGTTCTTC
TTATCATGCAGATTTACAAGCGAAAGGCGAGCTAGTTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy