Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1483 IGR1479 IGR1478 IGR1484 IGR1482 IGR1486 IGR1480 IGR1485 IGR1481 IGR1477 HD2014 ybeD, - HD2015 HD2011 rlpA, - HD2017 lipB, - HD2013 lipA, - HD2012 pbp5,dacA, - HD2016 purL, - HD2010 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009 HD2014 ybeD, - HD2015 HD2011 rlpA, - HD2017 lipB, - HD2013 lipA, - HD2012 pbp5,dacA, - HD2016 purL, - HD2010 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009 ybeD, - HD2015 HD2011 rlpA, - HD2017 lipB, - HD2013 lipA, - HD2012 pbp5,dacA, - HD2016 HD2014 purL, - HD2010 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009
* Calculated from Protein Sequence

Gene ID: HD2010

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purL  

Definition:
phosphoribosylformylglycinamidine synthase C-terminal fragment

Gene Start:
1674381

Gene Stop:
1674926

Gene Length:
546

Molecular Weight*:
20245

pI*:
6.80

Net Charge*:
-0.66

EC:
6.3.5.3  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Comment:
See HD2008, HD2009.

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to phosphoribosylformylglycinamidine synthase from H. influenzae (1172769, 1074100), E. coli (7428516, 131647), Salmonella typhimurium (1562537), Neisseria meningitidis (7379194), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0047
COG name: Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain
Functional Class: F
The phylogenetic pattern of COG0047 is amtkyqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 31-149 are 79% similar to a (SYNTHASE) protein domain (PD004290) which is seen in Q9CLW4_PASMU.

Residues 1-30 are 90% similar to a (SYNTHASE RIBOTIDE FORMYLGLYCINAMIDE) protein domain (PD009675) which is seen in Q9CLW4_PASMU.

Residues 150-177 are 85% similar to a (SYNTHASE RIBOTIDE FORMYLGLYCINAMIDE) protein domain (PD021025) which is seen in Q9CLW4_PASMU.



Paralogs:  Local Blast Search
HD2010 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLREQFSQFFANPNTLALGVCNGCQMVSNLAEIIPGTENWPRFVRNKSER
FEARVGLVKINDTHSAWFNGMAGSHMPIAVSHGEGQVEFKSAEQLAGLKA
QNLVIAQYIDNNGHPTEVYPANPNGSVDGITAISNLDGRVAIMMPHPERV
YRAVSNSWYPEDWHEDGAWMRLFRNARFALK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTACGAGAACAATTTAGCCAATTCTTCGCTAATCCAAATACTCTTGC
CTTAGGGGTATGTAATGGATGCCAGATGGTGTCTAATCTAGCTGAAATTA
TCCCGGGCACAGAAAATTGGCCACGTTTCGTCCGTAATAAATCTGAACGC
TTTGAAGCCCGTGTAGGATTAGTCAAAATCAATGACACTCACTCGGCTTG
GTTTAATGGCATGGCAGGCTCACATATGCCAATAGCCGTATCACACGGGG
AAGGGCAGGTTGAGTTTAAATCGGCTGAACAATTAGCGGGCTTAAAAGCA
CAAAATTTAGTTATCGCTCAATATATTGATAACAATGGTCATCCAACAGA
AGTCTATCCAGCCAATCCAAATGGTTCCGTGGACGGCATCACCGCTATCT
CAAATTTAGATGGTCGTGTCGCTATTATGATGCCACACCCAGAGCGTGTT
TACCGTGCTGTATCAAACTCTTGGTACCCTGAAGATTGGCACGAAGATGG
GGCTTGGATGCGATTATTTAGAAATGCACGATTCGCATTAAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy