Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1483 IGR1479 IGR1478 IGR1484 IGR1476 IGR1482 IGR1480 IGR1485 IGR1481 IGR1477 IGR1475 HD2014 ybeD, - HD2015 HD2011 lipB, - HD2013 lipA, - HD2012 mutY,micA, - HD2004 pbp5,dacA, - HD2016 hslV,clpQ, - HD2006 purL, - HD2010 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009 HD2014 ybeD, - HD2015 HD2011 lipB, - HD2013 lipA, - HD2012 mutY,micA, - HD2004 pbp5,dacA, - HD2016 hslV,clpQ, - HD2006 purL, - HD2010 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009 ybeD, - HD2015 HD2011 lipB, - HD2013 lipA, - HD2012 mutY,micA, - HD2004 pbp5,dacA, - HD2016 HD2014 hslV,clpQ, - HD2006 purL, - HD2010 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009
* Calculated from Protein Sequence

Gene ID: HD2009

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purL  

Definition:
phosphoribosylformylglycinamidine synthase

Gene Start:
1672641

Gene Stop:
1674356

Gene Length:
1716

Molecular Weight*:
62174

pI*:
5.10

Net Charge*:
-16.86

EC:
6.3.5.3  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Primary Evidence:
NULL

Secondary Evidence:
Maegawa T, Karasawa T, Ohta T, Wang X, Kato H, Hayashi H, Nakamura S.
Linkage between toxin production and purine biosynthesis in Clostridium difficile.
J Med Microbiol. 2002 Jan;51(1):34-41.
PMID: 11800470

Jackson M, Berthet FX, Otal I, Rauzier J, Martin C, Gicquel B, Guilhot C.
The Mycobacterium tuberculosis purine biosynthetic pathway: isolation and characterization of the purC and purL genes.
Microbiology. 1996 Sep;142 ( Pt 9):2439-47.
PMID: 8828210

Comment:
Curiously both HD2008 and HD2009 are equisimilar to PUR4_HAEIN but have no gross similarity to one another. See also HD2010.

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to phosphoribosylformylglycinamidine synthase from H. influenzae (1172769, 1074100), E. coli (131647), Salmonella typhimurium (1562537), Neisseria meningitidis (7227259), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0046
COG name: Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain
Functional Class:  F
The phylogenetic pattern of COG0046 is amtkyqvcebrh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 264-324 are 91% similar to a (SYNTHASE FORMYLGLYCINAMIDE RIBOTIDE) protein domain (PD384019) which is seen in PUR4_HAEIN.

Residues 50-263 are 87% similar to a (SYNTHASE RIBOTIDE FORMYLGLYCINAMIDE) protein domain (PD365057) which is seen in Q9CLW4_PASMU.

Residues 439-571 are 85% similar to a (SYNTHASE RIBOTIDE FORMYLGLYCINAMIDE) protein domain (PD009675) which is seen in PUR4_HAEIN.

Residues 342-404 are 58% similar to a (SYNTHASE RIBOTIDE) protein domain (PD358426) which is seen in PUR4_YEAST.

Residues 264-432 are 81% similar to a (SYNTHASE PHOSPHORIBOSYLFORMYLGLYCINAMIDINE) protein domain (PD001440) which is seen in Q9CLW4_PASMU.



Paralogs:  Local Blast Search
HD2009 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 287 to 435 (E-value = 2.5e-18) place HD2009 in the AIRS_C family which is described as AIR synthase related protein, C-terminal domain (PF02769)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSPLEIWCNESQERYVLAVATDKLATFEALCQRERAPYAIIGEATEEEHL
TLADQHFSNKPIDLPMNVLLGKTPKMHRDVSSKSVKNPPLDQQPIQLQEA
FHRVLRLPVVAEKTFLITIGDRSVTGMVARDQMVGPWQIPVSDVAVTTAS
LDSYHGEAMTMGERAPVALLDFAASARLAVAESITNIAGTYIGDIKRIKL
SANWMSAAGHTGEDAGLYEAVKAVGEELCPALGLTIPVGKDSMSMRTTWQ
ENGEQKAVTAPLSLVISAFARVEDVRKTVTPQLRTDKGLSSLFLIDLGEG
NNRLGATALAQVYKQLGDKPADIVNVAQLKNFYNAMQTLVAEDKLLAYHD
RSDGGLITTIAEMAFAGNCGVEIDIAALGDNDLAVLFNEELGAVIQVKDT
DLHRVREILTEHNLLGLTKDLGNVYADDRFIISRGNLKILNEKRSELRGI
WAELTHQMQRLRDNPECADQEFATKKDPNNKGLSAFLTYDVNQDIAAPFI
NTGVKPTIAILREQGVNSHYEMAAAFDRAGFNAIDVHMSDLMAGRHHLAN
FNALVACGGFSYGDVLGAGGG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCACCGCTTGAAATTTGGTGCAATGAATCGCAAGAGCGTTATGTATT
AGCCGTTGCCACTGATAAATTAGCAACCTTTGAAGCGCTCTGTCAACGAG
AACGCGCACCTTATGCCATTATCGGTGAAGCTACAGAAGAAGAACATTTA
ACCTTAGCCGACCAACATTTTTCGAACAAGCCTATTGATTTACCAATGAA
TGTATTATTAGGTAAAACACCTAAAATGCACCGTGATGTTTCATCAAAAA
GCGTTAAAAATCCACCGCTTGATCAGCAACCAATTCAACTACAAGAAGCG
TTTCATCGAGTATTACGCCTGCCTGTCGTAGCAGAAAAAACGTTTTTGAT
CACTATTGGAGACCGCTCTGTTACAGGTATGGTCGCACGCGATCAAATGG
TAGGGCCTTGGCAAATCCCGGTTTCAGATGTTGCGGTAACGACTGCGTCA
TTAGACAGTTATCACGGTGAAGCAATGACAATGGGCGAAAGAGCACCGGT
TGCATTGTTAGATTTTGCTGCATCTGCACGCTTAGCGGTCGCAGAATCGA
TCACCAATATAGCTGGCACCTATATAGGTGATATTAAACGCATTAAATTA
TCAGCAAACTGGATGTCCGCTGCCGGCCATACCGGTGAGGATGCTGGCTT
GTATGAAGCAGTCAAAGCGGTAGGTGAAGAGCTTTGCCCAGCGTTAGGTT
TAACGATTCCGGTCGGTAAAGATTCAATGTCAATGCGTACCACTTGGCAA
GAAAATGGCGAACAAAAAGCTGTTACCGCCCCGCTTTCTTTGGTTATTTC
CGCTTTTGCTCGAGTTGAAGATGTCCGTAAAACCGTTACACCACAATTAC
GCACGGATAAGGGCTTATCTAGTTTATTTTTAATTGACTTAGGGGAAGGA
AATAACCGCTTAGGTGCTACCGCATTGGCACAAGTTTATAAACAATTAGG
CGATAAACCCGCCGATATAGTAAATGTTGCTCAGCTGAAAAACTTCTACA
ATGCAATGCAAACATTAGTAGCTGAAGATAAATTACTGGCTTACCACGAC
CGTTCAGACGGTGGTTTAATTACCACGATTGCTGAAATGGCATTTGCTGG
CAATTGTGGCGTAGAAATAGATATTGCCGCACTTGGTGATAACGATCTAG
CCGTGTTATTTAATGAAGAATTAGGCGCTGTCATTCAAGTAAAAGATACC
GATCTTCACCGCGTACGTGAAATCTTAACCGAGCACAATTTACTTGGTTT
AACTAAAGACTTAGGTAATGTTTATGCTGACGATCGCTTCATTATTAGCC
GAGGCAATCTAAAAATTCTCAATGAAAAACGTTCTGAATTACGCGGTATT
TGGGCTGAATTAACCCACCAAATGCAACGATTACGTGATAACCCTGAATG
TGCCGATCAAGAATTTGCGACCAAAAAAGATCCAAATAACAAAGGCTTGT
CTGCATTCTTAACTTATGATGTCAATCAAGATATTGCTGCTCCATTTATT
AATACCGGCGTCAAACCAACAATCGCGATTTTACGCGAACAGGGCGTAAA
TAGTCATTATGAAATGGCCGCTGCGTTTGATCGAGCCGGCTTTAATGCGA
TTGACGTACATATGTCAGATTTAATGGCAGGACGCCATCATCTAGCCAAT
TTCAATGCTTTAGTGGCATGCGGTGGATTCTCATATGGTGATGTACTAGG
CGCTGGTGGTGGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy