Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1473 IGR1474 IGR1479 IGR1478 IGR1476 IGR1482 IGR1480 IGR1481 IGR1477 IGR1475 HD2003 HD2011 lipB, - HD2013 lipA, - HD2012 mutY,micA, - HD2004 mltC, - HD2002 hslV,clpQ, - HD2006 purL, - HD2010 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009 HD2003 HD2011 lipB, - HD2013 lipA, - HD2012 mutY,micA, - HD2004 mltC, - HD2002 hslV,clpQ, - HD2006 purL, - HD2010 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009 HD2011 lipB, - HD2013 lipA, - HD2012 mutY,micA, - HD2004 mltC, - HD2002 HD2003 hslV,clpQ, - HD2006 purL, - HD2010 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009
* Calculated from Protein Sequence

Gene ID: HD2008

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purL  

Definition:
phosphoribosylformylglycinamidine synthase

Gene Start:
1671030

Gene Stop:
1672613

Gene Length:
1584

Molecular Weight*:
58124

pI*:
5.80

Net Charge*:
-14.13

EC:
6.3.5.3  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Maegawa T, Karasawa T, Ohta T, Wang X, Kato H, Hayashi H, Nakamura S.
Linkage between toxin production and purine biosynthesis in Clostridium difficile.
J Med Microbiol. 2002 Jan;51(1):34-41.
PMID: 11800470

Jackson M, Berthet FX, Otal I, Rauzier J, Martin C, Gicquel B, Guilhot C.
The Mycobacterium tuberculosis purine biosynthetic pathway: isolation and characterization of the purC and purL genes.
Microbiology. 1996 Sep;142 ( Pt 9):2439-47.
PMID: 8828210

Comment:
Curiously both HD2008 and HD2009 are equisimilar to PUR4_HAEIN but have no gross similarity to one another. See also HD2010.

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to phosphoribosylformylglycinamidine synthase from H. influenzae (1172769, 1074100), E. coli (7428516), Salmonella typhimuriu (1562537), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0046
COG name: Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain
Functional Class:  F
The phylogenetic pattern of COG0046 is amtkyqvcebrh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 269-331 are 70% similar to a (SYNTHASE II) protein domain (PD004591) which is seen in PUR4_NEIMA.

Residues 78-184 are 38% similar to a (SYNTHASE FORMYLGLYCINAMIDE RIBOTIDE) protein domain (PD403192) which is seen in PUR4_YEAST.

Residues 223-268 are 91% similar to a (SYNTHASE FORMYLGLYCINAMIDE RIBOTIDE) protein domain (PD374060) which is seen in Q9CLW4_PASMU.

Residues 406-476 are 92% similar to a (SYNTHASE RIBOTIDE FORMYLGLYCINAMIDE) protein domain (PD404366) which is seen in PUR4_HAEIN.

Residues 184-222 are 94% similar to a (SYNTHASE) protein domain (PD009626) which is seen in Q9CLW4_PASMU.

Residues 199-267 are 39% similar to a (SYNTHASE FORMYLGLYCINAMIDE RIBOTIDE) protein domain (PD404496) which is seen in PUR4_ARATH.

Residues 6-183 are 61% similar to a (SYNTHASE FORMYLGLYCINAMIDE RIBOTIDE) protein domain (PD381546) which is seen in Q9CLW4_PASMU.

Residues 270-405 are 91% similar to a (SYNTHASE RIBOTIDE FORMYLGLYCINAMIDE) protein domain (PD364655) which is seen in PUR4_HAEIN.

Residues 406-526 are 88% similar to a (SYNTHASE PHOSPHORIBOSYLFORMYLGLYCINAMIDINE) protein domain (PD001440) which is seen in PUR4_VIBCH.



Paralogs:  Local Blast Search
HD2008 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 240 to 422 (E-value = 1.5e-38) place HD2008 in the AIRS family which is described as AIR synthase related protein, N-terminal domain (PF00586)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTVKTFRGSPALSEFRLNQLKQKLHQHNLSINTVYAEYMHFVDLNRPLTD
HENAELQELLHYGPTLAKHEPNGICLIVTPRIGTISSWSSKATDIAHNCG
LTAINRIERGLAYYFEFYEQPTDTQMETLKGLLHDRMLETVFDHSSQATD
LFAQQEAKPFTTIDILTGGRQALVEANQNLGLALADDEIDYLVENFTALK
RNPNDIELYMFAQANSEHCRHKIFNADWTIDGQKQSKSLFKMIKNTFEKT
PEHVLSAYKDNAAVMEGSKVGRWFPDEDGQYRAHQEDAHILMKVETHNHP
TAISPFPGAATGSGGEIRDEGATGRGAKPKAGLTGFSVSNLVIPDFKQPW
ENDLSKPSRIASALDIMLEGPLGGAAFNNEFGRPALLGYFRTYEEKVNSF
AGEEVRGYHKPIMLAGGIGNIRAEHVQKGEIPVGAKLIVLGGPAMNIGLG
GGAASSMTSGKSKEDLDFASVQRENPEMERRCQEVIDRCWQLGEDNPIAF
IHDVGAGGLSNAMPELVHDGGHGGKFD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGTAAAAACTTTTCGTGGCTCTCCAGCCCTCTCTGAATTTCGTTT
AAATCAACTCAAACAAAAACTGCACCAACATAACCTTTCAATCAACACAG
TTTATGCTGAATATATGCACTTTGTTGATTTAAATAGGCCGCTTACTGAC
CATGAAAATGCAGAACTCCAAGAGTTATTACACTATGGTCCAACACTTGC
CAAACACGAACCTAACGGCATTTGCTTAATTGTCACGCCTCGCATAGGCA
CTATTTCTAGTTGGTCTTCAAAAGCAACTGATATTGCACATAATTGTGGT
TTAACGGCCATTAATCGTATTGAACGTGGTTTAGCTTATTATTTTGAGTT
TTATGAACAACCAACAGATACACAAATGGAAACATTAAAAGGGTTGTTAC
ACGATCGTATGCTTGAAACAGTATTCGACCATTCATCACAAGCAACCGAT
CTTTTTGCTCAACAAGAAGCTAAACCTTTTACTACCATTGATATTTTAAC
CGGCGGCCGCCAAGCCTTAGTTGAAGCCAACCAGAATTTAGGTCTTGCCT
TAGCTGATGATGAAATTGACTATTTAGTGGAAAATTTCACCGCATTAAAG
CGTAATCCAAATGATATTGAATTATATATGTTTGCTCAAGCAAACTCTGA
GCATTGTCGCCATAAAATCTTCAATGCTGATTGGACAATCGACGGTCAAA
AACAGAGCAAATCATTGTTTAAAATGATTAAAAACACCTTCGAAAAAACA
CCAGAACACGTATTATCTGCCTATAAAGATAATGCAGCCGTAATGGAAGG
TTCAAAAGTTGGTCGTTGGTTCCCTGATGAAGATGGTCAATATCGTGCTC
ACCAAGAAGATGCACACATTCTAATGAAAGTAGAAACCCATAATCACCCA
ACCGCTATTTCCCCTTTCCCTGGAGCGGCTACCGGTTCAGGCGGTGAAAT
TCGTGATGAAGGAGCTACAGGACGAGGCGCAAAACCTAAAGCGGGCTTAA
CCGGCTTTTCCGTTTCTAACCTTGTGATCCCAGATTTTAAACAACCGTGG
GAAAATGATCTTTCAAAACCCTCTCGCATTGCTTCTGCATTAGATATTAT
GCTAGAAGGTCCATTAGGTGGTGCCGCATTTAATAATGAATTTGGTCGCC
CCGCGTTATTAGGTTACTTCCGGACTTACGAAGAAAAAGTAAATAGTTTT
GCAGGCGAAGAAGTAAGAGGTTACCACAAACCAATTATGCTAGCAGGCGG
GATCGGCAACATTCGTGCGGAACATGTACAAAAAGGTGAAATTCCAGTGG
GTGCCAAACTAATTGTATTAGGTGGACCAGCGATGAACATCGGCTTAGGT
GGTGGTGCTGCTTCATCAATGACCTCTGGTAAGTCTAAAGAAGATTTAGA
CTTTGCGTCCGTACAACGTGAAAATCCCGAGATGGAACGTCGTTGTCAAG
AAGTTATCGACCGCTGTTGGCAACTTGGTGAAGATAATCCGATTGCCTTC
ATACACGATGTCGGTGCCGGTGGTTTATCCAATGCTATGCCAGAATTAGT
TCACGACGGTGGCCATGGTGGCAAATTTGATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy