Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Phe-1 tRNA-Asn-1 IGR1474 IGR1473 IGR1478 IGR1476 IGR1471 IGR1477 IGR1475 IGR1472 HD2003 HD2000 mutY,micA, - HD2004 mltC, - HD2002 ffh, - HD1999 hslV,clpQ, - HD2006 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009 HD2003 HD2000 mutY,micA, - HD2004 mltC, - HD2002 ffh, - HD1999 hslV,clpQ, - HD2006 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009 HD2003 HD2000 mutY,micA, - HD2004 mltC, - HD2002 ffh, - HD1999 HD2001 HD2001 hslV,clpQ, - HD2006 hslU,clpY, - HD2007 purL, - HD2008 purL, - HD2009
* Calculated from Protein Sequence

Gene ID: HD2004

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
mutY  micA  

Definition:
A/G-specific adenine glycosylase

Gene Start:
1668668

Gene Stop:
1667580

Gene Length:
1089

Molecular Weight*:
41253

pI*:
8.60

Net Charge*:
5.46

EC:
3.2.2.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Michaels,M.L., Pham,L., Nghiem,Y., Cruz,C. and Miller,J.H.
MutY, an adenine glycosylase active on G-A mispairs, has homology
to endonuclease III
Nucleic Acids Res. 18 (13), 3841-3845 (1990)
Medline: 90326504

Tsai-Wu,J.J., Radicella,J.P. and Lu,A.L.
Nucleotide sequence of the Escherichia coli micA gene required for
A/G-specific mismatch repair: identity of micA and mutY
J. Bacteriol. 173 (6), 1902-1910 (1991)
Medline: 91161503

Guan,Y., Manuel,R.C., Arvai,A.S., Parikh,S.S., Mol,C.D.,
Miller,J.H., Lloyd,S. and Tainer,J.A.
MutY catalytic core, mutant and bound adenine structures define
specificity for DNA repair enzyme superfamily
Nat. Struct. Biol. 5 (12), 1058-1064 (1998)
Medline: 99061333




Comment:
From Genbank:[gi:1171084]
This enzyme is active on G-A and C-A mispairs.

From Genbank:[gi:127559]
This enzyme is active on G-A mispairs.mutY also corrects error-prone DNA synthesis past GO lesions which are due to the oxidatively damaged form of guanine:7,8-dihydro-8-oxoguanine.

For other "mut" genes, see HD1786 (mutT), HD2024 (mutS), HD0544 (mutH), HD0743 (mutL).

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to A/G-specific adenine glycosylase from H. influenzae (1171084), E. coli (127559), Salmonella typhimurium (462663), Neisseria meningitidis (7380256), among others.

HD2004 is similar to A/G-specific adenine glycosylase from C. trachomatis (CT107) and T. pallidum (TP0343). HD2004 is also similar to adenine glycosylase from C. pneumoniae (CPn0402) and to endonuclease III from T.pallidum (TP0775). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 7 clades of COG1194
COG name: A/G-specific DNA glycosylase
Functional Class: L
The phylogenetic pattern of COG1194 is --t-----ebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001502 (Endonuclease III) with a combined E-value of 1.4e-14.
    IPB001502C    97-128
    IPB001502D    134-160
    IPB001502E    178-205


ProDom Summary:  Protein Domain Search
Residues 213-355 are 43% similar to a (GLYCOSYLASE ADENINE A/G-SPECIFIC PROTEOME) protein domain (PD022372) which is seen in Q9CLC0_PASMU.

Residues 56-144 are 77% similar to a (ENDONUCLEASE COMPLETE PROTEOME III) protein domain (PD001558) which is seen in Q9CLC0_PASMU.

Residues 24-53 are 93% similar to a (GLYCOSYLASE ADENINE COMPLETE PROTEOME) protein domain (PD339571) which is seen in MUTY_HAEIN.

Residues 148-206 are 66% similar to a (GLYCOSYLASE ADENINE PROTEOME COMPLETE) protein domain (PD404678) which is seen in Q9CLC0_PASMU.



Paralogs:  Local Blast Search
HD2004 is paralogously related to HD1115 (1e-11).


Pfam Summary:  Pfam Search
Residues 32 to 167 (E-value = 7.8e-20) place HD2004 in the HhH-GPD family which is described as HhH-GPD superfamily base excision DNA repair protein (PF00730)

PDB Hit:
pdb|1MUY|A Chain A, Catalytic Domain Of Muty From Escherichia C... 310 2e-085
pdb|1MUN| Catalytic Domain Of Muty From Escherichia Coli D13... 308 6e-085

Gene Protein Sequence:
MPFAQAVLAWFKQYGRHHLPWQQNKTLYSVWLSEVMLQQTQVATVIPYFE
RFMVRFPSVIDLANAEIDEVLHLWTGLGYYARARNLHKAAQQIRDQFAGQ
FPREFDQVLSLAGIGRSTAGAILSSVLDVPYPILDGNVKRVLSRVFLVEG
WSGEKAVENKLWLLTAQVTPNRQVADFNQAMMDLGALVCSRSKPKCAICP
LETQCETARLAVWDKYPAKKPKKQLPERQTYFLVVKSGTRILLQQRAAKG
LWGGLYSFPQFEDFATIKRTISAKNWQISQQLITFRHTFSHFYLDITPIL
VDLEAQDSVQMPPLVAQEPVSDYCQSVSSSENYWYDLHATNEVGLAAPVK
KILDELSLTYKE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTTTTGCACAAGCAGTATTAGCTTGGTTTAAACAATATGGGCGGCA
TCATTTGCCGTGGCAACAAAATAAAACGTTATATAGTGTGTGGTTATCTG
AAGTTATGTTGCAACAAACGCAAGTCGCTACTGTCATACCTTATTTCGAA
CGCTTTATGGTGCGCTTTCCTTCGGTGATTGATTTAGCGAATGCTGAAAT
TGATGAAGTATTACATTTGTGGACAGGCTTGGGCTATTATGCACGTGCAC
GTAATTTACATAAAGCCGCGCAACAAATCCGTGATCAATTTGCTGGGCAA
TTTCCACGTGAGTTTGATCAGGTTTTGTCGCTGGCAGGCATTGGTAGAAG
CACGGCAGGTGCCATTTTATCTTCAGTGTTAGATGTGCCTTATCCCATCC
TAGATGGCAATGTAAAGCGGGTATTATCACGAGTTTTTCTTGTTGAGGGA
TGGAGTGGCGAAAAAGCGGTTGAAAATAAATTATGGTTATTAACTGCTCA
AGTTACACCGAATAGACAGGTCGCTGATTTTAACCAAGCAATGATGGATT
TAGGCGCATTAGTTTGTAGTCGCAGTAAGCCAAAATGTGCAATTTGTCCA
CTTGAAACGCAATGTGAAACCGCGCGTTTGGCTGTATGGGATAAATATCC
TGCTAAAAAGCCCAAAAAACAATTACCTGAGCGACAAACCTATTTTCTGG
TGGTTAAATCAGGTACACGCATTTTATTGCAACAGCGTGCAGCAAAAGGG
CTATGGGGGGGATTATACAGTTTTCCTCAGTTTGAAGATTTTGCCACCAT
TAAGCGGACTATTTCAGCTAAAAATTGGCAAATTTCCCAGCAGTTAATTA
CTTTTAGGCACACATTTAGCCACTTTTATTTGGATATTACCCCTATTTTG
GTCGATTTAGAAGCACAAGATTCTGTGCAAATGCCACCGCTTGTGGCACA
AGAGCCGGTGAGTGATTATTGTCAGTCTGTATCTTCAAGTGAGAATTATT
GGTATGATTTACACGCGACTAATGAAGTTGGCTTAGCTGCGCCGGTGAAA
AAAATTTTAGATGAACTTAGTTTGACGTATAAGGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy