Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Phe-1 tRNA-Asn-1 tRNA-SeC(p)-1 IGR1473 IGR1474 IGR1470 IGR1469 IGR1476 IGR1471 IGR1468 IGR1477 IGR1475 IGR1472 HD1997 HD2003 HD2000 mutY,micA, - HD2004 mltC, - HD2002 ffh, - HD1999 selA, - HD1994 HD1995 mioC, - HD1996 hslV,clpQ, - HD2006 hslU,clpY, - HD2007 purL, - HD2008 HD1997 HD2003 HD2000 mutY,micA, - HD2004 mltC, - HD2002 ffh, - HD1999 selA, - HD1994 HD1995 mioC, - HD1996 hslV,clpQ, - HD2006 hslU,clpY, - HD2007 purL, - HD2008 HD1997 HD2003 HD2000 mutY,micA, - HD2004 mltC, - HD2002 ffh, - HD1999 selA, - HD1994 HD2001 HD2001 mioC, - HD1996 hslV,clpQ, - HD2006 hslU,clpY, - HD2007 purL, - HD2008 HD1995
* Calculated from Protein Sequence

Gene ID: HD2002

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
mltC  

Definition:
membrane-bound lytic murein transglycosylase C

Gene Start:
1667288

Gene Stop:
1666185

Gene Length:
1104

Molecular Weight*:
41279

pI*:
10.70

Net Charge*:
23.83

EC:
3.2.1.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Aminosugars metabolism
Glycosaminoglycan degradation
N-Glycans biosynthesis
Nucleotide sugars metabolism

Secondary Evidence:
Dijkstra,A.J. and Keck,W.
Identification of new members of the lytic transglycosylase family
in Haemophilus influenzae and Escherichia coli
Microb. Drug Resist. 2 (1), 141-145 (1996)
MEDLINE: 97302490


Comment:
0

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to membrane-bound lytic murein transglycosylase from H. influenzae (1175303) and E. coli (2507395, 3024139). Also a hit to yggz protein from E. coli (7467175).

HD2002 is weakly similar to soluble lytic murein transglycosylase from T. pallidum (TP0043). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0741
COG name: Soluble lytic murein transglycosylase and related regulatory proteins
Functional Class:  M
The phylogenetic pattern of COG0741 is -----QVcEB-HUJ--oL--x
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB000189 (SLT domain) with a combined E-value of 1.2e-17.
    IPB000189A    224-248
    IPB000189B    267-281


ProDom Summary:  Protein Domain Search
Residues 194-315 are 74% similar to a (PROTEOME COMPLETE TRANSGLYCOSYLASE MUREIN LYTIC) protein domain (PD003175) which is seen in MLTC_HAEIN.

Residues 1-192 are 47% similar to a (MUREIN HYDROLASE LYTIC TRANSGLYCOSYLASE) protein domain (PD036146) which is seen in Q9CLB8_PASMU.

Residues 283-359 are 40% similar to a (E MUREIN HYDROLASE LYTIC) protein domain (PD347057) which is seen in MLTE_ECOLI.

Residues 316-363 are 56% similar to a (MUREIN HYDROLASE LYTIC TRANSGLYCOSYLASE) protein domain (PD346870) which is seen in MLTC_HAEIN.



Paralogs:  Local Blast Search


HD2002 is paralogously related to HD1400 (1e-06).


Pfam Summary:  Pfam Search
Residues 201 to 329 (E-value = 2.5e-33) place HD2002 in the SLT family which is described as Transglycosylase SLT domain (PF01464)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRKYAKYLPFCLVVPFLAACSSKSTTSAKGKKIKSPFNYLSKDTNGLDIL
TGQFSHNIDDIWGSNELLVASKKDYVKYTDKYYTRSHISFEDGLITIETL
GNQNHLRNSIIHTLLMGADPRGIDLFNSGDTPISKKPFLARQVKDQFGRD
IINVAIANDFASHLLQRQLKTRRLQNGRTVTYVTIKMVADHVEVRARKYL
PLVRKMAKRYGIETSLIFGIMEVESSFNPYAVSYANAIGLMQVVPRTAGR
DIFVRKGMSGQPDRAYLHEPANNIDAGTLYLAILRNEYLDGINDPVSKRY
AIISAYNSGAGAVLKVFDADRTSAFNRINQLSSDAVYRVLATAHPSKQAR
NYLNKVSKARQKYINIR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAAAATATGCTAAATATTTACCCTTTTGTTTGGTTGTTCCGTTTTT
AGCGGCGTGTAGTAGTAAGTCAACTACATCTGCAAAAGGTAAAAAAATTA
AATCACCCTTTAATTATTTATCTAAAGATACCAATGGATTAGATATTTTA
ACCGGTCAATTTTCGCATAATATTGATGATATTTGGGGCAGTAATGAATT
ATTAGTCGCCAGCAAAAAAGATTATGTCAAATATACGGATAAATATTACA
CACGTAGCCATATTTCATTTGAAGATGGATTGATTACCATTGAAACGCTA
GGTAACCAAAATCATTTACGCAATAGCATCATTCATACTTTATTGATGGG
AGCAGATCCGCGCGGTATTGATTTATTTAATTCAGGCGATACACCAATCA
GTAAAAAACCATTTTTAGCGCGTCAGGTTAAAGATCAATTTGGGCGTGAT
ATTATCAATGTTGCGATTGCAAACGATTTTGCTAGTCACTTGTTACAGCG
TCAATTAAAAACACGCCGTTTACAGAATGGGCGGACAGTCACTTACGTAA
CCATTAAAATGGTGGCTGATCACGTTGAAGTGCGGGCAAGAAAGTATTTG
CCTTTAGTTCGCAAAATGGCGAAACGTTATGGCATTGAAACAAGCTTAAT
TTTCGGCATTATGGAAGTAGAATCGTCCTTTAATCCGTATGCGGTCAGTT
ATGCAAATGCTATCGGTTTAATGCAAGTTGTACCGCGTACCGCTGGGCGG
GATATTTTTGTTCGTAAGGGAATGAGTGGCCAGCCTGATCGTGCTTATTT
GCATGAGCCTGCTAATAATATTGATGCGGGTACATTGTATTTAGCCATTT
TACGCAATGAATATTTAGACGGGATTAATGATCCGGTTTCAAAACGTTAT
GCGATTATTTCTGCTTATAACAGTGGTGCGGGCGCTGTTTTAAAAGTGTT
TGACGCAGATCGAACTTCTGCATTTAATCGTATTAACCAATTGTCTTCTG
ATGCGGTATATCGTGTTTTAGCTACAGCTCATCCATCTAAACAAGCGCGA
AATTACTTAAATAAAGTGTCTAAGGCGCGTCAAAAATATATAAATATTCG
TTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy