Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Phe-1 tRNA-Asn-1 tRNA-SeC(p)-1 IGR1470 IGR1469 IGR1467 IGR1471 IGR1468 IGR1472 HD1997 HD2000 mltC, - HD2002 sun, - HD1992 ffh, - HD1999 trkA, - HD1991 selB, - HD1993 HD1995 mioC, - HD1996 HD1997 HD2000 mltC, - HD2002 sun, - HD1992 ffh, - HD1999 trkA, - HD1991 selB, - HD1993 HD1995 mioC, - HD1996 HD1997 HD2000 mltC, - HD2002 sun, - HD1992 ffh, - HD1999 trkA, - HD1991 selB, - HD1993 HD2001 selA, - HD1994 selA, - HD1994 HD2001 mioC, - HD1996 HD1995
* Calculated from Protein Sequence

Gene ID: HD1994

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
selA  

Definition:
L-seryl-tRNA(Sec) selenium transferase

Gene Start:
1662176

Gene Stop:
1660794

Gene Length:
1383

Molecular Weight*:
50381

pI*:
8.00

Net Charge*:
4.44

EC:
2.9.1.1  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Selenoamino acid metabolism

Secondary Evidence:
Thanbichler M, Bock A.
Selenoprotein biosynthesis: purification and assay of components involved in selenocysteine biosynthesis and insertion in Escherichia coli.
Methods Enzymol. 2002;347:3-16.
PMID: 11898420

Engelhardt H, Forchhammer K, Muller S, Goldie KN, Bock A.
Structure of selenocysteine synthase from Escherichia coli and location of tRNA in the seryl-tRNA(sec)-enzyme complex.
Mol Microbiol. 1992 Dec;6(23):3461-7.
PMID: 1474891

Comment:
All three genes, selA , selB and selD are present to facilitate the insertion of selenocysteine in the peptide chain.

For other sel genes, see HD0577 (selD) and HD1993 (selB).

From Genbank:[gi:1173422]
This enzyme converts seryl-tRNA(Sec UCA) to selenocysteinyl-tRNA (Sec UCA) during selenoprotein biosynthesis.

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to L-seryl-tRNA(Sec) selenium transferase from H. influenzae (1173422), E. coli (7451551, 134421), Moorella thermoacetica (2440135), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1921
COG name: Selenocysteine synthase [L-seryl-tRNA(Ser) selenium transferase]
Functional Class: E
The phylogenetic pattern of COG1921 is -mt--q--e--huj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 4-132 are 48% similar to a (TRANSFERASE SELENIUM PROTEOME COMPLETE) protein domain (PD042142) which is seen in Q9CK66_PASMU.

Residues 134-322 are 68% similar to a (AMINOTRANSFERASE PHOSPHATE PYRIDOXAL COMPLETE PROTEOME) protein domain (PD000087) which is seen in SELA_HAEIN.

Residues 323-459 are 48% similar to a (TRANSFERASE SELENIUM SYNTHASE) protein domain (PD011766) which is seen in SELA_HAEIN.

Residues 4-129 are 47% similar to a (TRANSFERASE SELENIUM SYNTHASE CYSTEINYL-) protein domain (PD338666) which is seen in SELA_HAEIN.



Paralogs:  Local Blast Search
HD1994 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 81 to 448 (E-value = 4.2e-220) place HD1994 in the SelA family which is described as L-seryl-tRNA selenium transferase (PF03841)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQKLLSVIPSVDKLIKQLAGIALIQQYGHQAFVAQARQVIDSLRQHILTH
QSLPVDQPADNLLSLIATNLQQTQQIAMKKVFNLTGTILHTNLGRAIWSE
AAITAASDAMRHHSALEFDIEAGKRSHRDNTISQLLCEITGAEAACVVNN
NAAAVLLMLATFAKGKEVIVSRGELVEIGGAFRIPDIMQQAGCKLVEVGT
TNRTHLKDYRAAINENTALLMKVHTSNYQIQGFTHSVSEQQLVELGQEVG
LPVMSDLGSGSLIDMATFGLPAEPLVQQKVASGVALVTFSADKLLGGPQA
GIIVGKKADIEALQAHPLKRVLRCDKVILAGLEATLRHYLLPDQLTTHLP
TLSLLTQSIDHLRVKATRLQNSLSKRLDARYHLQIEQSLAQIGSGALPTE
RLASLAVTITAPTQRDLLQLEQQFKMLKYPIIGRFAEQKLWLDLRSVAQF
DQLIEMLEEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAAATTATTGAGTGTTATTCCATCCGTAGATAAATTAATCAAGCA
ACTAGCAGGTATAGCCTTGATTCAGCAATATGGTCATCAAGCTTTTGTGG
CACAGGCACGCCAAGTTATTGACAGCTTGCGACAGCATATTTTAACGCAT
CAATCTTTGCCTGTGGATCAGCCAGCGGATAATTTATTGTCTTTGATTGC
AACAAATTTACAGCAGACGCAACAGATAGCAATGAAGAAGGTTTTTAATT
TAACCGGGACGATATTGCACACGAATTTAGGCCGAGCAATTTGGTCAGAG
GCAGCCATTACGGCTGCTAGTGATGCGATGCGACATCACTCAGCTTTAGA
ATTTGATATTGAGGCAGGCAAACGATCTCATCGTGATAATACGATTTCTC
AATTACTCTGTGAGATCACGGGCGCTGAAGCGGCTTGTGTTGTGAATAAT
AATGCAGCGGCTGTTTTATTAATGTTAGCGACCTTTGCAAAAGGTAAAGA
GGTGATTGTTTCACGAGGTGAGTTAGTTGAAATTGGCGGGGCTTTTCGTA
TTCCAGACATTATGCAACAAGCGGGCTGTAAGTTAGTTGAAGTGGGCACC
ACTAATCGAACCCATTTAAAAGATTATCGAGCCGCTATTAATGAAAACAC
GGCGTTGTTAATGAAAGTACATACGAGTAATTACCAAATTCAAGGTTTTA
CCCATTCAGTATCAGAACAACAATTAGTTGAATTAGGTCAAGAAGTTGGT
TTACCCGTGATGAGTGATCTGGGGAGCGGTTCATTAATTGATATGGCGAC
CTTTGGTTTACCCGCGGAGCCGTTAGTACAACAGAAAGTAGCCAGCGGTG
TAGCGTTAGTTACTTTTTCTGCAGATAAACTGTTGGGCGGGCCACAAGCG
GGTATTATTGTTGGCAAAAAAGCTGATATTGAGGCATTGCAAGCACATCC
ACTGAAGCGAGTATTACGTTGTGATAAAGTGATTTTAGCTGGGCTAGAAG
CAACGTTAAGGCATTATTTATTGCCGGATCAACTCACTACACATTTACCA
ACGTTATCTTTATTAACCCAATCAATTGATCATTTACGTGTTAAAGCAAC
ACGTTTACAAAATAGCTTAAGTAAGCGGTTAGATGCGCGTTATCATTTAC
AGATTGAACAAAGCTTGGCTCAGATTGGTAGTGGAGCATTGCCCACGGAA
AGGTTAGCTTCATTAGCAGTTACTATTACGGCCCCCACGCAACGGGATTT
ATTGCAACTTGAACAACAATTTAAAATGCTGAAATATCCGATTATTGGTC
GTTTTGCTGAACAAAAATTATGGCTTGACCTTCGTTCAGTGGCACAATTT
GATCAGCTGATTGAGATGTTGGAGGAAAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy