Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1456 IGR1459 IGR1458 IGR1460 IGR1457 IGR1464 IGR1466 IGR1463 IGR1462 IGR1465 IGR1461 HD1989 rpS19, - HD1979 rpS10, - HD1984 rpL22, - HD1978 rpL4, - HD1982 rpL3, - HD1983 rpL2, - HD1980 sun, - HD1992 trkA, - HD1991 mviN, - HD1987 rpsT, - HD1990 tfoX,sxy, - HD1985 fumC, - HD1986 HD1989 rpS19, - HD1979 rpS10, - HD1984 rpL22, - HD1978 rpL4, - HD1982 rpL3, - HD1983 rpL2, - HD1980 sun, - HD1992 trkA, - HD1991 mviN, - HD1987 rpsT, - HD1990 tfoX,sxy, - HD1985 fumC, - HD1986 HD1989 rpS10, - HD1984 rpL22, - HD1978 rpL4, - HD1982 rpL3, - HD1983 rpL2, - HD1980 sun, - HD1992 trkA, - HD1991 mviN, - HD1987 rpL23,rplW, - HD1981 rpL23,rplW, - HD1981 rpS19, - HD1979 rpsT, - HD1990 tfoX,sxy, - HD1985 fumC, - HD1986
* Calculated from Protein Sequence

Gene ID: HD1986

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fumC  

Definition:
fumarate hydratase class II

Gene Start:
1652439

Gene Stop:
1653833

Gene Length:
1395

Molecular Weight*:
50472

pI*:
6.00

Net Charge*:
-6.51

EC:
4.2.1.2  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Citrate cycle (TCA cycle)
Reductive carboxylate cycle (CO2 fixation)

Secondary Evidence:
Ueda,Y., Yumoto,N., Tokushige,M., Fukui,K. and Ohya-Nishiguchi,H. Purification and characterization of two types of fumarase from Escherichia coli.
J. Biochem. 109(5): 728-733, 1991.
Medline: 92011457.

Weaver,T. and Banaszak,L.
Crystallographic studies of the catalytic and a second site in fumarase C from Escherichia coli.
Biochemistry 35(44): 13955-13965, 1996.
Medline: 97065812.

Woods,S.A., Miles,J.S., Roberts,R.E. and Guest,J.R.
Structural and functional relationships between fumarase and aspartase. Nucleotide sequences of the fumarase (fumC) and aspartase (aspA) genes of Escherichia coli K12.
Biochem. J. 237(2): 547-557, 1986.
Medline: 87099873.

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to fumarate hydratase class II from H. influenzae (6016063), Myxococcus xanthus (2384689), Helicobacter pylori (7436822, 6016064), among others.

HD1986 is similar to fumarate hydratase from, C. pneumoniae (CPn1013) and C. trachomatis (CT855). No similarity to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0114
COG name: Fumarase
Functional Class: C
The phylogenetic pattern of COG0114 is ----y--cebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000362 (Fumarate lyase) with a combined E-value of 9.1e-15.
    IPB000362A    185-198
    IPB000362B    317-327


ProDom Summary:  Protein Domain Search
Residues 212-409 are 81% similar to a (LYASE FUMARATE HYDRATASE COMPLETE) protein domain (PD000660) which is seen in Q9CMK1_PASMU.

Residues 3-205 are 80% similar to a (LYASE HYDRATASE FUMARATE COMPLETE) protein domain (PD002097) which is seen in Q9CMK1_PASMU.

Residues 242-456 are 41% similar to a (LYASE ADENYLOSUCCINATE BIOSYNTHESIS) protein domain (PD328331) which is seen in ASPA_BACSU.

Residues 410-460 are 94% similar to a (FUMARATE HYDRATASE PROTEOME COMPLETE) protein domain (PD404475) which is seen in Q9CMK1_PASMU.

Residues 410-461 are 75% similar to a (LYASE HYDRATASE FUMARATE FUMARASE) protein domain (PD408744) which is seen in FUMH_HUMAN.



Paralogs:  Local Blast Search
HD1986 is paralogously related to HD0564 (1e-99), HD1033 (1e-06) and HD1649 (2e-04).


Pfam Summary:  Pfam Search
Residues 11 to 342 (E-value = 3.5e-157) place HD1986 in the Lyase_1 family which is described as Lyase (PF00206)

PDB Hit:
pdb|1FUQ|A Chain A, Fumarase With Bound Pyromellitic Acid >gi|1... 511 7e-146
pdb|1FUO|A Chain A, Fumarase C With Bound Citrate >gi|1942161|p... 511 7e-146
pdb|2FUS|A Chain A, Mutations Of Fumarase That Distinguish Betw... 508 4e-145

Gene Protein Sequence:
MEYRIEKDTMGEVKVPADRYWAAQTERSRNNFRIGPEASMPVEIIEAFAY
LKKAAAFANAELGALTTEKRDLIAMVCDEILANKLADEFPLVIWQTGSGT
QSNMNLNEVIANRAHVLQGGALGEKSIIHPNDDVNKSQSSNDTYPTAMHI
AAYKKVVEVTIPAIERLQKTFAIKSEAFKDVVKIGRTHLMDATPLTLGQE
FSAYAAQLQFGLLALKNTLPHLAQLALGGTAVGTGLNTPKGYDVKVAEYI
AQFTQLPFITAENKFEALATHDAIIETHGALKQIAMSLFKIANDIRLLAS
GPRSGIGEILIPENEPGSSIMPGKVNPTQCEAMTMVAAQVLGNDTTISFA
GSQGHFQLNVFKPVMAANFLQSAQLLADVCISFDEHCASGIEPNYPRIQQ
QLENSLMLVTALNTHIGYENAAKIAKTAHKNGTTLKEEAINLGLVTAEQF
DQWVRPQNMVGSLK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAATACCGTATCGAAAAAGATACTATGGGCGAAGTGAAAGTACCGGC
TGATCGTTATTGGGCAGCACAAACAGAACGTTCGCGTAATAATTTCAGGA
TTGGGCCTGAAGCTTCTATGCCGGTCGAAATTATTGAAGCATTTGCTTAT
TTAAAAAAAGCCGCTGCATTTGCTAATGCTGAACTAGGTGCACTCACCAC
TGAAAAACGTGACTTAATCGCGATGGTTTGTGATGAAATCTTAGCAAATA
AATTAGCGGACGAATTTCCGTTAGTGATTTGGCAAACAGGTTCTGGTACA
CAATCAAATATGAATCTTAATGAAGTGATTGCCAACCGTGCCCACGTATT
ACAAGGGGGGGCATTAGGTGAAAAATCGATTATTCATCCAAATGATGATG
TCAATAAATCGCAATCTTCAAACGATACCTATCCAACGGCTATGCATATT
GCTGCCTATAAAAAAGTCGTTGAAGTAACCATTCCAGCAATAGAACGCTT
ACAAAAAACATTTGCCATAAAATCTGAAGCATTTAAAGATGTGGTTAAAA
TTGGTCGAACTCATTTAATGGATGCCACCCCGCTTACATTAGGCCAAGAA
TTCTCTGCCTATGCGGCACAATTACAATTTGGTTTGTTAGCCCTTAAAAA
TACCTTGCCCCATTTGGCGCAGTTAGCATTAGGTGGCACAGCTGTTGGCA
CAGGCTTAAATACGCCTAAAGGTTATGATGTTAAAGTAGCAGAATATATC
GCACAATTTACTCAACTTCCTTTTATTACTGCGGAAAATAAATTTGAAGC
ATTAGCCACTCACGATGCAATTATTGAAACACACGGTGCGCTCAAACAAA
TTGCTATGTCATTATTCAAAATTGCCAATGATATTCGTTTATTAGCATCA
GGTCCTCGCTCTGGTATTGGCGAAATTCTAATTCCTGAAAATGAACCCGG
CTCCTCAATTATGCCCGGTAAAGTCAATCCTACTCAATGTGAGGCAATGA
CTATGGTTGCAGCGCAAGTGTTGGGAAATGATACTACGATTTCATTTGCG
GGTAGCCAAGGCCATTTTCAGTTAAATGTTTTCAAACCTGTTATGGCAGC
AAATTTCTTACAATCGGCACAATTACTTGCTGATGTATGTATTTCATTTG
ATGAGCATTGTGCAAGCGGTATTGAACCTAATTATCCAAGAATTCAACAA
CAATTAGAAAACTCTTTAATGTTAGTGACCGCTTTAAATACCCATATTGG
TTATGAAAATGCGGCTAAAATTGCTAAAACTGCGCACAAAAATGGAACAA
CACTCAAAGAAGAAGCAATTAACTTAGGTCTAGTCACTGCTGAACAGTTT
GATCAATGGGTACGCCCTCAAAATATGGTCGGTAGTTTAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy