Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1441 IGR1452 IGR1442 IGR1443 IGR1450 IGR1448 IGR1456 IGR1454 IGR1444 IGR1445 IGR1459 IGR1446 IGR1449 IGR1455 IGR1458 IGR1457 IGR1447 IGR1453 IGR1451 rpL30,rpmD, - HD1960 rpL29, - HD1975 rpS17, - HD1974 rpS19, - HD1979 rpS14, - HD1965 rpL24, - HD1967 rpL22, - HD1978 rpL18, - HD1962 rpL14, - HD1968 rpS8, - HD1964 rpL16, - HD1976 rpL15, - HD1959 rps5,rpsE, - HD1961 insB, - HD1970 rpL6, - HD1963 rpL5, - HD1966 rpL4, - HD1982 rpL3, - HD1983 rpS3, - HD1977 rpL2, - HD1980 secY, - HD1957 HD1973 HD1972 rpL30,rpmD, - HD1960 rpL29, - HD1975 rpS17, - HD1974 rpS19, - HD1979 rpS14, - HD1965 rpL24, - HD1967 rpL22, - HD1978 rpL18, - HD1962 rpL14, - HD1968 rpS8, - HD1964 rpL16, - HD1976 rpL15, - HD1959 rps5,rpsE, - HD1961 insB, - HD1970 rpL6, - HD1963 rpL5, - HD1966 rpL4, - HD1982 rpL3, - HD1983 rpS3, - HD1977 rpL2, - HD1980 secY, - HD1957 HD1973 HD1972 rpS17, - HD1974 rpL22, - HD1978 rpL14, - HD1968 rpS8, - HD1964 rpL16, - HD1976 rpL15, - HD1959 rps5,rpsE, - HD1961 rpL6, - HD1963 rpL5, - HD1966 rpL4, - HD1982 rpL3, - HD1983 rpS3, - HD1977 rpL2, - HD1980 secY, - HD1957 insA, - HD1971 rpL23,rplW, - HD1981 rpL23,rplW, - HD1981 insB, - HD1970 rpL30,rpmD, - HD1960 rpL29, - HD1975 rpS19, - HD1979 rpS14, - HD1965 rpL24, - HD1967 rpL18, - HD1962 insA, - HD1971 HD1972 HD1973
* Calculated from Protein Sequence

Gene ID: HD1970

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
insB  

Definition:
insertion element IS1/IS150 protein

Gene Start:
1645869

Gene Stop:
1645366

Gene Length:
504

Molecular Weight*:
19549

pI*:
11.00

Net Charge*:
15.10

EC:
 

Functional Class:
Other categories; Transposase  

Pathway: pathway table

Secondary Evidence:
Haas M, Rak B.
Escherichia coli insertion sequence IS150: transposition via circular and linear intermediates.
J Bacteriol. 2002 Nov;184(21):5833-41.
PMID: 12374815

Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to insertion element IS1 protein InsB from E. coli (400069, 673426, 96127, 96126), Salmonella typhi (7800421, 7800418), Shigella sonnei (124922), among others. Also a significant hit to TnpH protein of Shigella flexneri.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1662
COG name: Insertion element IS1 protein InsB, putative transposase
Functional Class: L
The phylogenetic pattern of COG1662 is -----q-CE------------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 80-167 are identical to a (ELEMENT TRANSPOSITION IS1 TRANSPOSABLE) protein domain (PD005175) which is seen in INB1_ECOLI.

Residues 43-79 are identical to a (ELEMENT IS1 TRANSPOSITION INSERTION) protein domain (PD008049) which is seen in INB1_ECOLI.

Residues 1-42 are identical to a (IS1 TRANSPOSASE ELEMENT TRANSPOSITION) protein domain (PD015288) which is seen in INB1_ECOLI.



Paralogs:  Local Blast Search
HD1970 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 37 to 167 (E-value = 2.7e-112) place HD1970 in the Transposase_27 family which is described as IS1 transposase (PF03400)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MPGNSPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYV
GAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMT
DGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSV
ELHDKVIGHYLNIKHYQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGGGCAACAGCCCGCATTATGGGCGTTGGCCTCAACACGATTTTAC
GTCACTTAAAAAACTCAGGCCGCAGTCGGTAACCTCGCGCATACAGCCGG
GCAGTGACGTCATCGTCTGCGCGGAAATGGACGAACAGTGGGGCTATGTC
GGGGCTAAATCGCGCCAGCGCTGGCTGTTTTACGCGTATGACAGTCTCCG
GAAGACGGTTGTTGCGCACGTATTCGGTGAACGCACTATGGCGACGCTGG
GGCGTCTTATGAGCCTGCTGTCACCCTTTGACGTGGTGATATGGATGACG
GATGGCTGGCCGCTGTATGAATCCCGCCTGAAGGGAAAGCTGCACGTAAT
CAGCAAGCGATATACGCAGCGAATTGAGCGGCATAACCTGAATCTGAGGC
AGCACCTGGCACGGCTGGGACGGAAGTCGCTGTCGTTCTCAAAATCGGTG
GAGCTGCATGACAAAGTCATCGGGCATTATCTGAACATAAAACACTATCA
ATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy