Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1438 IGR1429 IGR1431 IGR1437 IGR1440 IGR1433 IGR1435 IGR1427 IGR1432 IGR1436 IGR1428 IGR1430 IGR1439 IGR1434 rpL36, - HD1955 rpS16, - HD1949 rpL19, - HD1946 rpS13, - HD1954 rpL17,rplQ, - HD1950 rpS11, - HD1953 rimM, - HD1948 rpS4, - HD1952 trmD, - HD1947 glyQ, - HD1943 rpoA, - HD1951 secY, - HD1957 glyS, - HD1942 HD1944 HD1945 rpL36, - HD1955 rpS16, - HD1949 rpL19, - HD1946 rpS13, - HD1954 rpL17,rplQ, - HD1950 rpS11, - HD1953 rimM, - HD1948 rpS4, - HD1952 trmD, - HD1947 glyQ, - HD1943 rpoA, - HD1951 secY, - HD1957 glyS, - HD1942 HD1944 HD1945 rpL19, - HD1946 rpL17,rplQ, - HD1950 rpS11, - HD1953 rimM, - HD1948 rpS4, - HD1952 trmD, - HD1947 glyQ, - HD1943 rpoA, - HD1951 secY, - HD1957 glyS, - HD1942 rpS16, - HD1949 rpS13, - HD1954 rpL36, - HD1955 HD1944 HD1945
* Calculated from Protein Sequence

Gene ID: HD1947

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
trmD  

Definition:
tRNA (Guanine-N(1)-)-methyltransferase (M1G-methyltransferase)

Gene Start:
1635612

Gene Stop:
1634857

Gene Length:
756

Molecular Weight*:
28432

pI*:
5.50

Net Charge*:
-4.17

EC:
2.1.1.31  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Secondary Evidence:
Hjalmarsson,K.J., Bystrom,A.S. and Bjork,G.R. .
Purification and characterization of transfer RNA (guanine-1)methyltransferase from Escherichia coli.
J. Biol. Chem. 258(2): 1343-1351.1983
Medline: 83108856.

Bystrom AS, Hjalmarsson KJ, Wikstrom PM, Bjork GR. .
The nucleotide sequence of an Escherichia coli operon containing genes for the tRNA(m1G)methyltransferase, the ribosomal proteins S16 and L19 and a 21-K polypeptide.
Embo J. 2(6): 899-905.1983
Medline: 84057772.


Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to tRNA (guanine N-1)-Methyltransferase from H. influenzae (1174776), Serratia marcescens (549125), E. coli (136249), Salmonella typhimurium (549124), among others.


HD1947 is similar to tRNA (guanine N-1)-Methyltransferase from C. pneumoniae (CPn0117), C. trachomatis (CT027), T. pallidum (TP0908), M. pneumoniae (MP0183), M. genitalium (MG445), U. urealyticum (UU567).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0336
COG name: tRNA-(guanine-N1)-methyltransferase
Functional Class: J
The phylogenetic pattern of COG0336 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002649 (tRNA (guanine-N1-)-methyltransferase) with a combined E-value of 2.4e-119.
    IPB002649A    1-13
    IPB002649B    39-64
    IPB002649C    106-127
    IPB002649D    134-175
    IPB002649E    179-227


ProDom Summary:  Protein Domain Search
Residues 22-235 are 83% similar to a (METHYLTRANSFERASE TRNA) protein domain (PD004978) which is seen in Q9CLE1_PASMU.



Paralogs:  Local Blast Search


HD1947 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 22 to 235 (E-value = 9.9e-128) place HD1947 in the tRNA_m1G_MT family which is described as tRNA (Guanine-1)-methyltransferase (PF01746)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MWIGIISLFPEMFKAITDFGVTGRAIKQNLLQIECWNPRDFTFDKHHTVD
DRPYGGGPGMLMMVQPLRDAIQVAKQVARSEDGVEAKVIYLSPQGRKLDQ
QGVRELSANRKLILICGRYEGVDERLIQSEVDEEWSIGDYVLTGGELPAM
TLIDAIARFVPGVLGKQASALEDSFAEGLLDCPHYTRPEVLDNMPVPQVL
MSGNHEQIRKWRLAQSLERTWLRRPELLDSLALTDEQRVLLAKIKQQYKI
S$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGATTGGTATCATTTCACTTTTCCCTGAGATGTTTAAAGCAATTAC
CGATTTTGGGGTGACAGGACGCGCAATTAAACAAAATCTTCTGCAGATTG
AATGTTGGAATCCTCGTGATTTCACTTTTGATAAGCATCATACGGTTGAT
GATCGTCCTTATGGCGGTGGTCCGGGTATGTTAATGATGGTGCAACCATT
ACGTGATGCGATTCAGGTTGCTAAACAAGTTGCTCGATCAGAAGATGGGG
TGGAAGCTAAAGTCATTTATCTTTCGCCACAAGGACGTAAACTTGATCAA
CAAGGCGTGCGTGAACTTTCTGCTAACCGTAAATTAATTTTGATTTGTGG
TAGATATGAGGGGGTTGATGAGCGTTTGATTCAATCTGAAGTTGATGAAG
AATGGTCAATCGGTGATTACGTGCTAACAGGCGGGGAATTACCTGCAATG
ACATTAATTGATGCCATTGCGAGATTTGTGCCAGGTGTATTGGGTAAGCA
AGCTTCAGCGTTGGAAGATTCTTTTGCTGAAGGTTTATTAGATTGCCCTC
ATTATACCCGTCCAGAAGTGTTGGATAATATGCCTGTTCCTCAAGTGCTG
ATGTCGGGAAATCATGAGCAGATTCGTAAATGGCGCTTAGCGCAGTCATT
AGAACGCACGTGGTTACGACGCCCTGAGCTATTAGATAGCCTAGCTCTGA
CTGACGAACAACGCGTGTTGTTGGCTAAAATTAAGCAGCAATACAAAATC
AGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy