Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1425 IGR1429 IGR1431 IGR1426 IGR1433 IGR1435 IGR1427 IGR1432 IGR1428 IGR1430 IGR1424 IGR1434 rpS16, - HD1949 rpL19, - HD1946 HD1941 rpL17,rplQ, - HD1950 rimM, - HD1948 trmD, - HD1947 glyQ, - HD1943 xerC, - HD1940 rpoA, - HD1951 glyS, - HD1942 HD1944 HD1939 HD1938 HD1945 rpS16, - HD1949 rpL19, - HD1946 HD1941 rpL17,rplQ, - HD1950 rimM, - HD1948 trmD, - HD1947 glyQ, - HD1943 xerC, - HD1940 rpoA, - HD1951 glyS, - HD1942 HD1944 HD1939 HD1938 HD1945 rpL19, - HD1946 HD1941 rimM, - HD1948 trmD, - HD1947 glyQ, - HD1943 xerC, - HD1940 rpoA, - HD1951 glyS, - HD1942 rpS16, - HD1949 rpL17,rplQ, - HD1950 HD1944 HD1939 HD1938 HD1945
* Calculated from Protein Sequence

Gene ID: HD1943

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glyQ  

Definition:
glycyl-tRNA synthetase alpha subunit

Gene Start:
1632999

Gene Stop:
1632091

Gene Length:
909

Molecular Weight*:
34390

pI*:
4.90

Net Charge*:
-8.92

EC:
6.1.1.14  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glycine, serine and threonine metabolism

Secondary Evidence:
Arnez JG, Dock-Bregeon AC, Moras D.
Glycyl-tRNA synthetase uses a negatively charged pit for specific recognition and activation of glycine.
J Mol Biol. 1999 Mar 12;286(5):1449-59.
PMID: 10064708

Webster,T.A., Gibson,B.W., Keng,T., Biemann,K. and Schimmel,P.
Primary structures of both subunits of Escherichia coli glycyl-tRNA synthetase.
J. Biol. Chem. 258(17): 10637-10641 1983.
Medline: 83290996.

Keng,T., Webster,T.A., Sauer,R.T. and Schimmel,P.
Gene for Escherichia coli glycyl-tRNA synthetase has tandem subunit coding regions in the same reading frame.
J. Biol. Chem. 257(21): 12503-12508. 1982
Medline: 83030764.

Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to glycyl tRNA synthetase from H. influenzae (1174510), E. coli (586055, 146222), Neisseria meningitidis (7227190), among others.

HD1944 is similar to glycyl tRNA synthetase from C. trachomatis (CT796) and C. pneumoniae (CPn0946). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 8 clades of COG0752
COG name: Glycyl-tRNA synthetase, alpha subunit
Functional Class: J
The phylogenetic pattern of COG0752 is -----qvceb-huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 10-296 are 87% similar to a (SYNTHETASE CHAIN ALPHA LIGASE) protein domain (PD006985) which is seen in SYGA_HAEIN.



Paralogs:  Local Blast Search

HD1943 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 299 (E-value = 1.1e-240) place HD1943 in the tRNA_synt_2e family which is described as Glycyl-tRNA synthetase alpha subunit (PF02091)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSTKFNVKTFQGMILALQEYWANVGCTIVQPFDMEVGAGTSHPMTALRAL
GPEPMAFAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYL
GSLKMLGFDPTQHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQ
QVGGLECKPVTGEVTYGLERLAMYIQGVDSVYDLVYSDGPLGKTTYGDVF
HQNEVEQSTYNFEYADVDFLFKAFEQYEKEAQELLALEKPLPLPAYERVL
KAAHSFNMLDARKAISVTERQRYILRIRALTKGVAEAYYASREALGFPGC
NK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCACAAAATTTAATGTTAAAACTTTCCAAGGCATGATCTTAGCCCT
GCAAGAATATTGGGCAAATGTGGGCTGTACTATCGTACAGCCTTTTGATA
TGGAAGTTGGAGCAGGGACTTCTCATCCAATGACTGCATTACGAGCACTT
GGTCCAGAGCCAATGGCATTTGCTTATGTACAGCCTTCACGCCGTCCAAC
AGATGGTCGTTATGGTGAAAATCCTAACCGCTTGCAACATTATTATCAAT
TTCAAGTTGTTATCAAACCTTCGCCGGACAATATTCAAGAGCTTTATTTA
GGTTCTCTTAAAATGCTTGGTTTTGATCCAACTCAACACGATATTCGCTT
TGTAGAAGATAACTGGGAAAATCCAACCTTAGGTGCTTGGGGGCTTGGTT
GGGAAGTTTGGTTAAATGGAATGGAAGTGACTCAGTTCACTTATTTTCAA
CAAGTGGGCGGTTTAGAATGTAAACCTGTAACAGGTGAAGTGACTTATGG
TTTAGAGCGTTTAGCGATGTATATTCAAGGCGTGGATTCTGTTTATGATT
TAGTGTATTCAGACGGTCCATTAGGCAAAACGACTTATGGTGATGTTTTC
CATCAAAACGAAGTGGAACAATCAACTTATAACTTTGAATATGCGGATGT
AGATTTCTTATTTAAAGCCTTTGAACAATACGAAAAAGAAGCACAAGAAC
TGTTAGCGCTTGAAAAACCATTACCCTTGCCAGCTTACGAACGTGTTTTA
AAAGCTGCACATAGTTTCAATATGTTAGATGCGCGTAAAGCCATTTCAGT
GACTGAGCGTCAACGTTATATTTTACGTATCCGTGCACTCACTAAAGGTG
TTGCTGAAGCTTATTATGCAAGCCGTGAAGCGTTAGGCTTCCCTGGTTGT
AATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy