Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1425 IGR1429 IGR1431 IGR1426 IGR1427 IGR1422 IGR1432 IGR1428 IGR1423 IGR1430 IGR1424 rpL19, - HD1946 HD1941 rimM, - HD1948 trmD, - HD1947 glyQ, - HD1943 xerC, - HD1940 glyS, - HD1942 HD1944 HD1939 HD1937 HD1938 HD1936 HD1945 rpL19, - HD1946 HD1941 rimM, - HD1948 trmD, - HD1947 glyQ, - HD1943 xerC, - HD1940 glyS, - HD1942 HD1944 HD1939 HD1937 HD1938 HD1936 HD1945 rpL19, - HD1946 HD1941 rimM, - HD1948 trmD, - HD1947 glyQ, - HD1943 xerC, - HD1940 glyS, - HD1942 HD1944 HD1939 HD1937 HD1938 HD1936 HD1945
* Calculated from Protein Sequence

Gene ID: HD1942

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glyS  

Definition:
glycyl-tRNA synthetase beta subunit

Gene Start:
1632051

Gene Stop:
1629985

Gene Length:
2067

Molecular Weight*:
75641

pI*:
5.30

Net Charge*:
-14.45

EC:
6.1.1.14  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glycine, serine and threonine metabolism

Secondary Evidence:
Arnez JG, Dock-Bregeon AC, Moras D.
Glycyl-tRNA synthetase uses a negatively charged pit for specific recognition and activation of glycine.
J Mol Biol. 1999 Mar 12;286(5):1449-59.
PMID: 10064708

Webster,T.A., Gibson,B.W., Keng,T., Biemann,K. and Schimmel,P.
Primary structures of both subunits of Escherichia coli glycyl-tRNA synthetase.
J. Biol. Chem. 258(17): 10637-10641 1983.
Medline: 83290996.

Keng,T., Webster,T.A., Sauer,R.T. and Schimmel,P.
Gene for Escherichia coli glycyl-tRNA synthetase has tandem subunit coding regions in the same reading frame.
J. Biol. Chem. 257(21): 12503-12508. 1982
Medline: 83030764.

Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to from H. influenzae (1174512), E. coli (586056), Neisseria meningitidis (7227187), B. subtilis (1711631), among others.

HD1944 is similar to glycyl tRNA synthetase from C. trachomatis
(CT796) and C. pneumoniae (CPn0946). No similarities to U.
urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0751
COG name: Glycyl-tRNA synthetase, beta subunit
Functional Class: J
The phylogenetic pattern of COG0751 is -----qvceb-huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR01045 (Glycyl-tRNA synthetase beta subunit signature) with a combined E-value of 2.4e-54.
    PR01045A    7-20
    PR01045B    50-62
    PR01045C    246-261
    PR01045D    318-334
    PR01045E    394-413


ProDom Summary:  Protein Domain Search
Residues 526-687 are 83% similar to a (SYNTHETASE CHAIN BETA LIGASE) protein domain (PD351074) which is seen in SYGB_HAEIN.

Residues 510-660 are 24% similar to a (COMPLETE ORF MITOCHONDRION PROTEOME) protein domain (PD000146) which is seen in SYGB_BUCAI.



Paralogs:  Local Blast Search


HD1942 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 579 to 677 (E-value = 2.4e-05) place HD1942 in the tRNA-synt_1d_C family which is described as DALR anticodon binding domain (PF05746)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTTENFLVEIGTEELPPKALKKLATAFADNIQAELEQAGLAFEKIEWFAT
PRRLAVKVLSLAIAQPSKEIEKRGPAVGSAFDADGQPTKAAEGWARGCGI
SVEQADRVVTDKGEWLVHRAVVEGKPTKDLLVDMVASALAKLPIAKPMRW
ADKTVQFIRPVHTVTLLLGNELIEGEILGITIANVVRGHRFLGESQFQIA
HADEYPQILRDKGAVIADFAERKAIILRDAQAKAAALGGVADIEDDLLEE
VTSLVEYPNVLVAKFEERFLAVPAEALVYTMKGDQKYFPIYDKEGNLLPH
FIFVSNINPQDPSAIIEGNEKVVRPRLSDAEFFFKTDLKQRLVDQLPRLE
TVLFQQQLGTLRDKTDRIEQLSGVIAEQIGADVQKAKRAGLLSKCDLMTN
MVFEFTDTQGVMGMHYARHDGEAEEVAVALNEQYMPRFAGDALPTSLVAC
SVALADKIDTLTGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKKLPLDL
VHLVEKSTGLFGDKLTNKAVVADVVDFMLGRFRAWYQDEGIAVDVIQAVL
ARRPTKPADFDARVRAVSHFRTFESAEALAAANKRVTNILAKADIAIGEI
NLSACVEPTERALAEAVLALKDEVRPLIAKANYTAVLTQLANLRTPVDNF
FDHVMVNAEDPSLRQNRLAILSTLQSLFLEVADISLLQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACAGAAAACTTTTTAGTCGAAATCGGTACCGAAGAGCTACCTCC
GAAAGCGCTCAAAAAATTGGCTACTGCGTTTGCAGATAATATACAAGCTG
AGTTAGAACAGGCAGGGCTTGCATTTGAGAAAATAGAATGGTTTGCTACG
CCACGGCGTTTAGCGGTGAAAGTATTAAGCCTTGCAATAGCGCAACCGAG
CAAAGAGATTGAAAAGCGTGGTCCTGCAGTGGGCTCGGCGTTTGATGCAG
ATGGTCAACCAACGAAAGCAGCAGAAGGCTGGGCGCGTGGTTGTGGTATT
TCGGTAGAGCAAGCCGATCGTGTTGTAACCGATAAAGGTGAATGGTTAGT
ACACCGTGCTGTGGTTGAGGGGAAGCCAACAAAAGATTTATTAGTGGATA
TGGTGGCAAGCGCATTAGCAAAATTGCCGATTGCAAAACCAATGCGTTGG
GCCGACAAAACTGTGCAATTTATTCGTCCGGTGCATACTGTAACTTTATT
GCTAGGTAATGAGTTAATCGAAGGCGAGATTTTGGGGATAACCATTGCCA
ATGTTGTGCGAGGTCACCGTTTCTTGGGCGAAAGCCAATTCCAAATTGCG
CACGCTGATGAATACCCACAAATTTTACGTGATAAAGGCGCAGTGATTGC
AGACTTTGCAGAACGTAAAGCGATTATTTTACGTGATGCACAAGCTAAAG
CGGCAGCGCTTGGCGGTGTGGCGGATATTGAAGACGACTTGTTAGAAGAA
GTGACTTCATTAGTGGAATATCCAAATGTGTTAGTGGCAAAATTTGAAGA
GCGTTTCCTTGCAGTGCCTGCCGAAGCATTGGTTTACACCATGAAAGGCG
ACCAAAAATATTTCCCGATTTACGATAAAGAAGGCAACTTGCTACCGCAC
TTTATTTTTGTTTCAAACATTAATCCACAAGATCCAAGCGCAATTATTGA
AGGGAATGAAAAGGTGGTTCGTCCACGTTTATCGGATGCAGAATTTTTCT
TTAAAACGGATTTAAAACAGCGTTTAGTAGATCAACTACCGCGTTTAGAA
ACGGTATTATTCCAACAGCAATTAGGCACATTACGTGATAAAACCGACCG
CATTGAGCAATTAAGCGGTGTAATCGCAGAGCAAATCGGTGCAGATGTGC
AAAAAGCAAAACGTGCAGGATTGCTGTCTAAATGTGACTTAATGACCAAT
ATGGTGTTTGAGTTTACTGATACGCAAGGTGTGATGGGAATGCATTACGC
GCGTCACGATGGTGAAGCGGAAGAAGTGGCAGTGGCATTAAATGAGCAAT
ATATGCCACGTTTTGCCGGTGATGCGTTGCCCACTTCTTTAGTGGCTTGT
TCAGTGGCATTAGCGGATAAAATTGATACTTTAACCGGTATTTTTGGGAT
AGGCCAGCATCCAAAAGGTGATAAAGATCCATTTGCACTTCGTCGTGCGG
CATTAGGTGTGTTGCGGATTATCGTAGAGAAAAAATTGCCATTAGATTTA
GTCCATTTAGTGGAAAAATCGACCGGATTATTTGGTGATAAATTAACGAA
TAAAGCCGTTGTTGCTGATGTGGTGGATTTTATGCTTGGTCGCTTCCGTG
CGTGGTATCAAGATGAAGGTATTGCAGTAGATGTGATTCAGGCGGTATTG
GCTCGTCGTCCAACTAAACCTGCGGATTTTGATGCACGTGTGCGTGCTGT
TTCGCATTTCCGCACTTTTGAATCAGCAGAAGCATTAGCGGCAGCTAATA
AACGTGTAACGAATATTTTAGCGAAAGCAGATATTGCAATTGGTGAAATC
AATTTAAGCGCTTGTGTAGAGCCTACTGAGCGTGCTTTAGCGGAAGCCGT
GCTTGCTTTAAAAGATGAAGTTAGACCATTAATTGCTAAAGCGAACTATA
CCGCAGTATTAACACAATTAGCCAATTTACGTACGCCAGTGGATAACTTC
TTTGATCATGTAATGGTTAATGCAGAAGATCCTAGTTTACGCCAAAACCG
GTTAGCTATTTTAAGCACGTTGCAAAGTTTGTTCTTAGAAGTCGCGGATA
TTTCATTGCTACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy