Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-2 IGR1415 IGR1420 IGR1418 IGR1421 IGR1422 IGR1423 IGR1413 IGR1417 IGR1424 IGR1414 IGR1416 IGR1419 HD1930 HD1926 HD1927 xerC, - HD1940 acpP, - HD1931 HD1939 HD1937 dod, - HD1929 HD1938 HD1936 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 HD1930 HD1926 HD1927 xerC, - HD1940 acpP, - HD1931 HD1939 HD1937 dod, - HD1929 HD1938 HD1936 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 Type: tandem, Name:  - 19 HD1930 HD1927 xerC, - HD1940 HD1926 acpP, - HD1931 HD1939 HD1937 dod, - HD1929 HD1938 HD1936 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 tmk, - HD1933 tmk, - HD1933
* Calculated from Protein Sequence

Gene ID: HD1933

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tmk  

Definition:
thymidylate kinase (DTMP)

Gene Start:
1624224

Gene Stop:
1624922

Gene Length:
699

Molecular Weight*:
25884

pI*:
8.40

Net Charge*:
1.92

EC:
2.7.4.9  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Reynes,J.P., Tiraby,M., Baron,M., Drocourt,D. and Tiraby,G. 1996. Escherichia coli thymidylate kinase: molecular cloning, nucleotide sequence, and genetic organization of the corresponding tmk locus. J. Bacteriol. 178(10): 2804-2812. Medline: 96213019.

Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to thymidylate kinase (dTMP) from H. influenzae (1074411, 1730073), Yersinia pestis (6016463), E. coli (1730072), among others.


HD1933 is similar to thymidylate kinase (dTMP) from C. trachomatis
(CT188), M. pneumoniae (MP0148), C. pneumoniae (CPn0273), M. genitalium (MG006), U. urealyticum (UU020), T. pallidum (TP0354).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0125
COG name: Thymidylate kinase
Functional Class: F
The phylogenetic pattern of COG0125 is AmTkyqvceBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000062 (Thymidylate kinase) with a combined E-value of 1.8e-36.
    IPB000062A    28-41
    IPB000062B    85-98
    IPB000062C    106-129
    IPB000062D    153-169


ProDom Summary:  Protein Domain Search
Residues 26-104 are 73% similar to a (KINASE NUCLEOTIDE THYMIDYLATE) protein domain (PD403036) which is seen in KTHY_HAEIN.

Residues 28-98 are 50% similar to a (KINASE THYMIDYLATE TRANSFERASE) protein domain (PD104249) which is seen in KTHY_CHLTR.

Residues 105-225 are 72% similar to a (KINASE THYMIDYLATE TRANSFERASE NUCLEOTIDE) protein domain (PD002766) which is seen in KTHY_HAEIN.

Residues 28-103 are 61% similar to a (KINASE THYMIDYLATE TRANSFERASE NUCLEOTIDE) protein domain (PD375183) which is seen in Q9KQI2_VIBCH.



Paralogs:  Local Blast Search
HD1933 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 31 to 220 (E-value = 1.5e-72) place HD1933 in the Thymidylate_kin family which is described as Thymidylate kinase (PF02223)

PDB Hit:
pdb|4TMK|A Chain A, Complex Of E. Coli Thymidylate Kinase With ... 235 3e-063

Gene Protein Sequence:
MNTIKLSSNGLKLNVTRKMRTNNMRGKFIVLEGLEGAGKTTAHQIILTQL
KQAGIQQIVQTREPGGTPLAEKLRYLIKHEFEEPISPQAELLMLYAARAQ
LVENVIKPALSAGKWVLGDRHDMSSQAYQGGGRQLDVALLNSLKESVLGP
FEPDLTIYLDIDPAIGLARASGCGELDRIEQQSLDFFYRTRERYLALTQH
NEKAVIINAEQPLEKVTNDIQQAVQKFLTFAQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACACAATAAAGCTGTCCAGCAATGGATTAAAATTGAACGTAACAAG
AAAAATGAGAACAAATAATATGCGTGGTAAATTTATCGTTTTAGAAGGTT
TAGAAGGCGCAGGAAAAACAACTGCTCATCAAATTATTTTAACACAACTG
AAACAAGCGGGCATTCAGCAAATTGTACAAACACGTGAGCCTGGCGGAAC
ACCGTTGGCAGAGAAATTACGCTATTTAATCAAACATGAGTTTGAAGAAC
CGATTAGCCCTCAAGCTGAGCTATTAATGCTATATGCGGCTCGTGCTCAA
TTAGTTGAAAATGTTATTAAACCTGCTCTCAGCGCGGGTAAATGGGTATT
AGGCGATCGGCACGATATGTCTTCACAAGCCTATCAAGGTGGTGGCCGTC
AACTAGATGTTGCTTTATTAAATAGCCTAAAAGAAAGTGTATTAGGTCCG
TTTGAACCAGACTTAACGATTTATCTTGATATTGATCCAGCCATTGGCTT
GGCGCGTGCGAGTGGGTGTGGTGAATTAGATCGGATTGAACAGCAAAGTT
TAGATTTCTTCTACCGTACACGCGAACGTTATTTAGCACTCACTCAACAT
AATGAAAAAGCCGTGATTATCAACGCTGAGCAACCACTTGAAAAAGTGAC
GAACGATATTCAACAAGCGGTCCAAAAATTTCTAACTTTTGCACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy