Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-2 IGR1415 IGR1420 IGR1418 IGR1421 IGR1422 IGR1412 IGR1413 IGR1411 IGR1417 IGR1414 IGR1416 IGR1419 HD1930 HD1926 HD1927 acpP, - HD1931 rpoZ, - HD1923 HD1937 dod, - HD1929 HD1936 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 recG, - HD1921 HD1930 HD1926 HD1927 acpP, - HD1931 rpoZ, - HD1923 HD1937 dod, - HD1929 HD1936 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 recG, - HD1921 Type: tandem, Name:  - 19 HD1930 HD1927 HD1926 acpP, - HD1931 rpoZ, - HD1923 dod, - HD1929 HD1936 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 recG, - HD1921 tmk, - HD1933 tmk, - HD1933 HD1937
* Calculated from Protein Sequence

Gene ID: HD1929

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dod  

Definition:
D-ribulose-phosphate-3 epimerase

Gene Start:
1621673

Gene Stop:
1622347

Gene Length:
675

Molecular Weight*:
24564

pI*:
5.30

Net Charge*:
-6.41

EC:
5.1.3.1  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Carbon fixation
Pentose and glucuronate interconversions
Pentose phosphate pathway

Secondary Evidence:
Lyngstadaas,A., Lobner-Olesen,A. and Boye,E.
Characterization of three genes in the dam-containing operon of Escherichia coli.
Mol. Gen. Genet. 247(5): 546-554.(1995)
Medline: 95327050.


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to ribulose-phosphate-3 epimerase from H. influenzae (1169388, 1074047), E. coli (1169387), Serratia marcescens (1169389), Neisseria meningitidis (7226484), among others.

HD1929 is similar to D-ribulose-phosphate-3 epimerase from C. trachomatis (CT121), T. pallidum (TP0945), C. pneumoniae (CPn0185), M. pneumoniae (MP0581), M. genitalium (MG112), U. urealyticum (UU456).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0036
COG name: Pentose-5-phosphate-3-epimerase
Functional Class: G
The phylogenetic pattern of COG0036 is -m--yqvcEbrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000056 (Ribulose-phosphate 3-epimerase) with a combined E-value of 8.7e-91.
    IPB000056A    8-40
    IPB000056B    66-94
    IPB000056C    108-160
    IPB000056D    176-205


ProDom Summary:  Protein Domain Search
Residues 7-73 are 88% similar to a (3-EPIMERASE RIBULOSE-PHOSPHATE ISOMERASE) protein domain (PD003683) which is seen in Q9CKJ6_PASMU.

Residues 74-148 are 82% similar to a (3-EPIMERASE RIBULOSE-PHOSPHATE ISOMERASE) protein domain (PD328129) which is seen in Q9CKJ6_PASMU.

Residues 90-216 are 35% similar to a (CARBOHYDRATE ISOMERASE 5.1.3.- SGCE) protein domain (PD094873) which is seen in SGCE_ECOLI.

Residues 83-222 are 42% similar to a (DECARBOXYLASE LYASE SYNTHASE PYRIMIDINE BIOSYNTHESIS) protein domain (PD001042) which is seen in Q9RUI5_DEIRA.



Paralogs:  Local Blast Search
HD1929 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 208 (E-value = 1.6e-130) place HD1929 in the Ribul_P_3_epim family which is described as Ribulose-phosphate 3 epimerase family (PF00834)

PDB Hit:
pdb|1RPX|A Chain A, D-Ribulose-5-Phosphate 3-Epimerase From Sol... 189 4e-049

Gene Protein Sequence:
MAQQPFLIAPSILSADLARLGDDVNQVLTAGADIIHFDVMDNHFVPNLTF
GPMICQALRNYGITAEIDVHLMVKPVERIIPDFAKAGANYITFHPEATDH
IDRTLQLIHQYGCKAGLVFNPATPLHYLDYVIDKIDMILLMGVNPGFGGQ
TFIPSTLTKLREVRQRIDASGKSIRLEIDGGVKIDNIAEIAAAGADTFVA
GSAIFDQQNYKSVIDQMRAELSKI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACAACAACCTTTTCTTATTGCACCATCTATTCTATCTGCTGATCT
TGCCCGCTTAGGTGATGATGTCAACCAAGTATTAACAGCAGGGGCAGACA
TTATCCATTTTGATGTAATGGATAACCATTTCGTGCCAAACCTAACCTTT
GGCCCAATGATCTGCCAAGCATTACGTAATTATGGCATTACGGCAGAAAT
TGACGTACATCTGATGGTCAAACCGGTGGAACGGATAATTCCTGACTTCG
CCAAAGCAGGAGCGAATTATATTACTTTCCACCCTGAAGCGACTGATCAT
ATTGACCGCACCTTGCAATTAATCCATCAATATGGTTGTAAAGCAGGCTT
AGTGTTCAATCCCGCCACACCACTGCATTACCTTGATTATGTAATAGATA
AAATCGATATGATTTTATTAATGGGCGTTAATCCAGGCTTTGGCGGACAA
ACATTTATTCCAAGTACATTAACCAAATTACGAGAAGTCCGCCAACGGAT
TGATGCCAGTGGAAAAAGTATCCGCTTAGAAATTGATGGCGGAGTAAAAA
TTGACAATATTGCAGAAATTGCCGCAGCAGGCGCAGATACATTCGTGGCA
GGTTCAGCGATTTTTGATCAACAAAACTATAAAAGCGTTATCGATCAAAT
GCGGGCAGAATTATCCAAGATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy