Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-2 IGR1415 IGR1420 IGR1418 IGR1421 IGR1412 IGR1413 IGR1411 IGR1417 IGR1414 IGR1416 IGR1419 HD1930 HD1926 HD1927 acpP, - HD1931 rpoZ, - HD1923 dod, - HD1929 HD1936 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 recG, - HD1921 HD1930 HD1926 HD1927 acpP, - HD1931 rpoZ, - HD1923 dod, - HD1929 HD1936 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 recG, - HD1921 Type: tandem, Name:  - 19 HD1930 HD1927 HD1926 acpP, - HD1931 rpoZ, - HD1923 dod, - HD1929 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 recG, - HD1921 tmk, - HD1933 tmk, - HD1933 HD1936
* Calculated from Protein Sequence

Gene ID: HD1926

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
50S ribosomal protein L36

Gene Start:
1621144

Gene Stop:
1621013

Gene Length:
132

Molecular Weight*:
5101

pI*:
11.70

Net Charge*:
12.07

EC:
 

Functional Class:
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 3-43 are 78% similar to 24212199 R362_VIBCH 50S ribosomal protein L36 2.

Three weakly significant hits using gapped BLAST to 50S ribosomal protein L36 from Neisseria meningitidis (7226179), Chloroplast Guillardia theta (391583), and Rickettsia prowazekii (6226002).

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0257
COG name: Ribosomal protein L36
Functional Class: J
The phylogenetic pattern of COG0257 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000473 (Ribosomal protein L36) with a combined E-value of 1.1e-16.
    IPB000473    6-42


ProDom Summary:  Protein Domain Search
Residues 3-43 are 78% similar to a (RIBOSOMAL 50S CHLOROPLAST PROTEOME) protein domain (PD002101) which is seen in Q9KTM3_VIBCH.



Paralogs:  Local Blast Search
HD1926 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 43 (E-value = 3.1e-05) place HD1926 in the Ribosomal_L36 family which is described as Ribosomal protein L36 (PF00444)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MCMKILNSLKTAKSRHPDCQIVRRKGKLYVICKTNPRFKARQR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGCATGAAAATTTTAAATTCATTAAAAACAGCTAAATCACGTCATCC
AGATTGCCAAATCGTTCGTCGTAAAGGTAAGTTGTACGTTATTTGTAAAA
CGAATCCGCGTTTTAAGGCACGCCAGCGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy