Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-2 IGR1415 IGR1420 IGR1418 IGR1412 IGR1413 IGR1411 IGR1417 IGR1414 IGR1410 IGR1416 IGR1419 HD1930 HD1926 HD1927 acpP, - HD1931 rpoZ, - HD1923 dod, - HD1929 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 recG, - HD1921 HD1930 HD1926 HD1927 acpP, - HD1931 rpoZ, - HD1923 dod, - HD1929 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 recG, - HD1921 Type: tandem, Name:  - 19 HD1930 HD1927 HD1926 acpP, - HD1931 rpoZ, - HD1923 dod, - HD1929 menB, - HD1925 holB, - HD1935 HD1932 spoT, - HD1924 recG, - HD1921 tmk, - HD1933 tmk, - HD1933
* Calculated from Protein Sequence

Gene ID: HD1925

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
menB  

Definition:
dihydroxynaphthoic acid synthase

Gene Start:
1619987

Gene Stop:
1620844

Gene Length:
858

Molecular Weight*:
31912

pI*:
6.40

Net Charge*:
-2.63

EC:
4.1.3.36  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Ubiquinone biosynthesis

Secondary Evidence:
Sharma,V., Suvarna,K., Meganathan,R. and Hudspeth,M.E.
Menaquinone (vitamin K2) biosynthesis: nucleotide sequence and expression of the menB gene from Escherichia coli.
J. Bacteriol. 174(15): 5057-5062, 1992.
Medline: 92332442.

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to naphthoate synthase from H. parahaemolyticus (1086070), H. influenzae (1170915), E. coli (126968), Synechocystis sp. (7428382), among others. Also many hits to putative enoyl-CoA hydratase/isomerase from Arabidopsis thaliana (2462733), Archaeoglobus fulgidus (7428375), and to crotonase from Thermoanaerobacterium thermosaccharolyticum (1903327), among others.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0447
COG name: Dihydroxynaphthoic acid synthase
Functional Class:  H
The phylogenetic pattern of COG0447 is a------cebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001753 (Enoyl-CoA hydratase/isomerase) with a combined E-value of 2.5e-52.
    IPB001753A    37-48
    IPB001753B    73-87
    IPB001753C    121-142
    IPB001753D    164-205
    IPB001753E    269-274


ProDom Summary:  Protein Domain Search
Residues 200-278 are 96% similar to a (COMPLETE PROTEOME HYDRATASE ENOYL-COA ISOMERASE ACID) protein domain (PD001362) which is seen in MENB_HAEIN.

Residues 37-206 are 26% similar to a (HYDROLYZING RING ENZYME) protein domain (PD204940) which is seen in O87872_THAAR.

Residues 150-199 are 92% similar to a (SYNTHASE PROTEOME COMPLETE SYNTHETASE) protein domain (PD416055) which is seen in Q9KQM5_VIBCH.

Residues 37-113 are 72% similar to a (PROTEOME COMPLETE SYNTHASE MENB) protein domain (PD337314) which is seen in Q9CLV5_PASMU.

Residues 37-149 are 67% similar to a (HYDRATASE ENOYL-COA COMPLETE PROTEOME ACID LYASE FATTY) protein domain (PD000523) which is seen in MENB_HAEIN.



Paralogs:  Local Blast Search

HD1925 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 35 to 206 (E-value = 1.7e-71) place HD1925 in the ECH family which is described as Enoyl-CoA hydratase/isomerase family (PF00378)

PDB Hit:
pdb|1DUB|D Chain D, 2-Enoyl-Coa Hydratase, Data Collected At 10... 97 2e-021
pdb|1NZY|B Chain B, 4-Chlorobenzoyl Coenzyme A Dehalogenase Fro... 70 4e-013
pdb|1NZY|A Chain A, 4-Chlorobenzoyl Coenzyme A Dehalogenase Fro... 70 4e-013

Gene Protein Sequence:
MLYPSEEFLYAPIEWVDHSKGYTDIHYHKSTDGIAKITINRPKVRNAFRP
QTVKEMINAFTDARFDEKIGVIVLTGEGEYAFCAGGDQKIRGDYGGYQDD
QGVHHLNILEFQRDIRTCPKPVVAMVAGYAVGGGHVLHMMCDITIAAENA
KFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRMYDAQEALNMGL
VNTVVPYADLEKETVRWCREMLQNSPIALRCLKAALNADCDGQAGLQELA
GNATMLFYMTEEGQEGRNAFNEKREPDFSKFKRNP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTATATCCAAGCGAAGAATTTCTTTATGCTCCGATTGAATGGGTCGA
TCATAGCAAAGGCTACACTGATATTCATTATCATAAATCAACTGACGGTA
TCGCTAAAATTACGATTAATCGCCCAAAAGTCCGCAATGCTTTTCGTCCT
CAAACCGTAAAAGAGATGATCAACGCTTTTACTGATGCTCGCTTTGATGA
AAAAATAGGCGTAATTGTGTTAACCGGTGAAGGAGAATATGCGTTTTGCG
CCGGCGGCGACCAAAAAATTCGTGGCGATTACGGCGGTTATCAAGATGAC
CAAGGTGTTCATCACCTCAATATACTTGAATTTCAGCGTGATATTAGAAC
CTGTCCAAAACCCGTAGTAGCAATGGTAGCAGGCTACGCCGTTGGTGGTG
GCCATGTATTACATATGATGTGCGATATAACTATTGCCGCTGAAAATGCT
AAATTTGGGCAAACTGGTCCGAAAGTCGGTTCCTTTGATGGTGGCTGGGG
GGCAAGCTATATGGCGCGCATCGTTGGTCAGAAAAAAGCTCGTGAAATTT
GGTTCTTATGCCGTATGTATGATGCTCAAGAAGCATTAAATATGGGCTTA
GTTAACACCGTTGTGCCTTATGCCGATCTTGAAAAAGAAACCGTGCGTTG
GTGCCGTGAAATGTTACAAAATAGCCCAATCGCCTTACGCTGTTTGAAAG
CAGCACTCAATGCCGATTGTGATGGCCAAGCTGGTTTACAAGAATTAGCG
GGCAACGCAACCATGCTGTTCTATATGACAGAAGAAGGCCAAGAAGGCCG
AAATGCTTTCAACGAAAAACGTGAACCAGACTTTAGTAAATTCAAGCGTA
ATCCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy