Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Lys-2 IGR1415 IGR1418 IGR1412 IGR1411 IGR1413 IGR1409 IGR1417 IGR1414 IGR1410 IGR1416 IGR1419 HD1930 HD1926 HD1927 HD1920 proS, - HD1919 acpP, - HD1931 rpoZ, - HD1923 dod, - HD1929 menB, - HD1925 HD1932 spoT, - HD1924 recG, - HD1921 HD1930 HD1926 HD1927 HD1920 proS, - HD1919 acpP, - HD1931 rpoZ, - HD1923 dod, - HD1929 menB, - HD1925 HD1932 spoT, - HD1924 recG, - HD1921 Type: tandem, Name:  - 19 HD1930 HD1927 HD1920 proS, - HD1919 HD1926 acpP, - HD1931 rpoZ, - HD1923 dod, - HD1929 menB, - HD1925 HD1932 spoT, - HD1924 recG, - HD1921
* Calculated from Protein Sequence

Gene ID: HD1924

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
spoT  

Definition:
guanosine-3',5'-bis(diphosphate)3'- pyrophosphohydrolase

Gene Start:
1618162

Gene Stop:
1619868

Gene Length:
1707

Molecular Weight*:
65007

pI*:
9.30

Net Charge*:
10.92

EC:
3.1.7.2  

Functional Class:
Regulatory functions; Other  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Sarubbi,E., Rudd,K.E., Xiao,H., Ikehara,K., Kalman,M. and Cashel,M. 1989. Characterization of the spoT gene of Escherichia coli. J. Biol. Chem. 264(25): 15074-15082. Medline: 89359321. Xiao,H., Kalman,M., Ikehara,K., Zemel,S., Glaser,G. and Cashel,M. 1991. Residual guanosine 3",5"-bispyrophosphate synthetic activity of relA null mutants can be eliminated by spoT null mutations. J. Biol. Chem. 266(9): 5980-5990. Medline: 91170285.

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to guanosine-3',5'-bis(diphosphate) 3'- pyrophosphohydrolase (SpoT) from E. coli (134837), H. influenzae (1174427), Neisseria meningitidis (738055, 7226911), among others. Also many significant hits to GTP pyrophosphokinase RelA from Myxococcus xanthus (6647734), Staphylococcus aureus (6647733), Bacillus subtilis (6647736), among others.

HD1924 is similar to guanosine-3",5"-bis(diphosphate) 3"- pyrophosphohydrolase from U. urealyticum (UU283), M. genitalium (MG278), and M. pneumoniae (MP0441). No similarities to C. trachomatis, C. pneumoniae, and T. pallidum.


COGS Summary:  COGS Search
BeTs to 9 clades of COG0317
COG name: Guanosine polyphosphate pyrophosphohydrolases/synthetases
Functional Class: T,K
The phylogenetic pattern of COG0317 is -----qvcEbrHujgpo----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 179-344 are 65% similar to a (SYNTHETASE PROTEOME COMPLETE KINASE) protein domain (PD002902) which is seen in SPOT_HAEIN.

Residues 16-143 are 81% similar to a (SYNTHETASE COMPLETE PROTEOME) protein domain (PD002764) which is seen in Q9CMB3_PASMU.

Residues 179-228 are 52% similar to a (PROTEOME MANGANESE) protein domain (PD411297) which is seen in Q9CMB3_PASMU.

Residues 144-188 are 60% similar to a (SYNTHETASE GTP KINASE PYROPHOSPHOKINASE) protein domain (PD334556) which is seen in Q9LVJ3_ARATH.

Residues 386-478 are 69% similar to a (SYNTHETASE COMPLETE PROTEOME KINASE) protein domain (PD003989) which is seen in SPOT_ECOLI.

Residues 144-178 are 94% similar to a (HYDROLASE COMPLETE) protein domain (PD368508) which is seen in Q9CMB3_PASMU.

Residues 103-143 are 80% similar to a (SYNTHETASE PPGPP PROTEOME GTP) protein domain (PD378346) which is seen in SPOT_ECOLI.



Paralogs:  Local Blast Search
HD1924 is paralogously related to HD1185 (2e-91).


Pfam Summary:  Pfam Search
Residues 45 to 144 (E-value = 1.8e-16) place HD1924 in the HD family which is described as HD domain (PF01966)
Residues 235 to 347 (E-value = 1.6e-55) place HD1924 in the RelA_SpoT family which is described as Region found in RelA / SpoT proteins (PF04607)
Residues 384 to 447 (E-value = 2.8e-27) place HD1924 in the TGS family which is described as TGS domain (PF02824)
Residues 493 to 566 (E-value = 3.7e-06) place HD1924 in the ACT family which is described as ACT domain (PF01842)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LHLFEPLHSIIQTYLPTDKIEWIQRAFVVARDAHEGQTRSSGEPYITHPV
AVATIIAEMKLDHEAIMAALLHDVIEDTPYTEEELAAEFGSNVAKIVQGV
SKLDKLKFRTRQEAQVENFRKMILAMTKDIRVVLIKLADRTHNMRTLGSL
RPDKRRRIAKETLEIYSPIAHRLGIEHLKNELENLCFQAMHPYRYRILRL
AIDMARGTRQDLLSTISHEIQMRLDEMGIKGRVYGREKHLYALYEKMRQR
DQHFHSILDIYAFRIVVNSIDNCYRVLGQMHALYKPRPYQIRDYIAVPKS
NGYQSLHTSMIGHKGMPIEVQIRTEDMDLMAELGVAAHWRYSEDQTQTTS
VQQKAQQWLRSIVELQQSAGNSDEFIENVKSDLFSDDIYVFTPKGRIVEL
PAKATAIDFAYAVHSDIGDCCIGATVDRKPYPISQPLESGQTVEIITKAG
KHPKRAWLNFVVTAKARSKIKAALKQFELIAEKPEETEKVEQLDIELEIK
DQIGVLANITNTIASMNSNIGMIESRPNDKGNYQVKIRISVTDKTHLYVV
IQKLIRVRGVIRVAKVSA$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCATCTTTTTGAGCCGCTTCATAGCATTATTCAAACTTATTTACCTAC
CGATAAAATCGAGTGGATACAACGCGCTTTTGTCGTGGCTCGTGATGCTC
ACGAAGGTCAAACTCGCTCTAGTGGTGAGCCTTATATTACTCATCCAGTC
GCGGTTGCCACCATTATTGCTGAAATGAAATTAGATCATGAAGCGATTAT
GGCTGCTTTATTACATGATGTTATTGAAGATACGCCCTATACTGAAGAAG
AATTAGCGGCTGAATTTGGTAGTAATGTTGCAAAAATCGTACAAGGCGTT
TCAAAACTAGATAAATTAAAATTCCGTACCCGCCAAGAAGCTCAAGTTGA
AAACTTCCGTAAAATGATCTTGGCAATGACCAAAGATATTCGTGTAGTAC
TAATTAAATTAGCCGACCGCACGCATAATATGCGGACGCTGGGTTCACTT
CGTCCAGATAAACGCCGTCGTATTGCTAAAGAAACACTAGAAATCTATAG
CCCTATTGCCCATCGTTTGGGAATTGAGCATCTGAAAAATGAATTGGAAA
ATTTATGCTTTCAAGCCATGCATCCTTATCGTTATCGCATTTTACGTTTA
GCCATTGATATGGCTCGAGGCACTCGTCAAGATCTGCTTTCAACTATCTC
GCACGAAATACAAATGCGTTTAGATGAAATGGGGATTAAAGGCCGTGTTT
ACGGGCGTGAAAAACATCTTTACGCCTTGTATGAAAAAATGCGTCAGCGT
GATCAACATTTTCATTCTATTTTGGATATCTATGCTTTTCGTATTGTAGT
CAATTCGATCGATAATTGTTATCGCGTACTTGGACAAATGCACGCGCTAT
ATAAACCTAGACCATACCAAATCCGTGACTATATTGCCGTGCCAAAAAGC
AATGGCTATCAATCATTACATACGTCAATGATTGGCCATAAAGGTATGCC
GATTGAAGTGCAAATCCGCACTGAAGATATGGACTTAATGGCAGAATTAG
GCGTTGCTGCCCATTGGCGTTATAGTGAAGATCAAACACAAACCACGAGC
GTACAGCAAAAAGCACAACAATGGCTACGCAGTATTGTTGAATTACAACA
AAGCGCGGGTAATTCCGATGAGTTTATTGAAAACGTTAAATCGGATCTTT
TTTCAGATGATATTTATGTGTTCACGCCAAAAGGTAGAATTGTCGAATTA
CCTGCTAAAGCGACCGCTATTGACTTTGCCTATGCAGTACATTCAGATAT
TGGCGATTGTTGTATTGGTGCAACCGTTGATCGTAAGCCATATCCGATTT
CACAACCGCTAGAATCGGGTCAAACCGTTGAAATTATTACCAAAGCCGGT
AAACATCCAAAACGTGCATGGCTAAATTTTGTGGTCACCGCCAAAGCGCG
ATCAAAAATTAAAGCGGCCCTTAAACAGTTTGAACTGATTGCTGAAAAAC
CAGAAGAAACAGAGAAAGTTGAACAATTAGATATCGAACTAGAAATTAAA
GATCAAATTGGCGTGCTTGCTAATATTACAAACACTATCGCGTCTATGAA
TAGCAACATTGGTATGATTGAAAGTCGCCCAAATGATAAAGGCAACTACC
AAGTGAAAATACGAATTAGCGTAACAGATAAAACGCATTTATACGTCGTT
ATTCAAAAATTGATCAGAGTCCGCGGTGTGATACGTGTGGCAAAAGTCAG
CGCCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy