Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1404 IGR1407 IGR1405 IGR1412 IGR1406 IGR1408 IGR1411 IGR1409 IGR1410 asnC, - HD1911 HD1915 HD1920 HD1916 proS, - HD1919 HD1912 rpoZ, - HD1923 yhdM, - HD1917 asnA, - HD1913 spoT, - HD1924 recG, - HD1921 asnC, - HD1911 HD1915 HD1920 HD1916 proS, - HD1919 HD1912 rpoZ, - HD1923 yhdM, - HD1917 asnA, - HD1913 spoT, - HD1924 recG, - HD1921 asnC, - HD1911 HD1915 HD1920 HD1916 proS, - HD1919 HD1912 yhdM, - HD1917 asnA, - HD1913 spoT, - HD1924 recG, - HD1921 HD1918 HD1918 rpoZ, - HD1923
* Calculated from Protein Sequence

Gene ID: HD1919

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
proS  

Definition:
prolyl-tRNA synthetase (proline-tRNA ligase)

Gene Start:
1614307

Gene Stop:
1612592

Gene Length:
1716

Molecular Weight*:
63536

pI*:
5.20

Net Charge*:
-15.09

EC:
6.1.1.15  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Arginine and proline metabolism

Secondary Evidence:
Beuning PJ, Musier-Forsyth K.
Species-specific differences in amino acid editing by class II prolyl-tRNA synthetase.
J Biol Chem. 2001 Aug 17;276(33):30779-85.
PMID: 11408489

Stathopoulos C, Li T, Longman R, Vothknecht UC, Becker HD, Ibba M, Soll D.
One polypeptide with two aminoacyl-tRNA synthetase activities.
Science. 2000 Jan 21;287(5452):479-82.
PMID: 10642548

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to prolyl-tRNA synthetase (ProS) from H. influenzae (1174537), E. coli (7428474, 586061, 48783), Neisseria meningitidis (7380194), among others. Also some significant hits to RNA synthesis factor (drpA) from E. coli (145803, 303557), and Streptococcus mutans (3873219).

HD1919 is similar to prolyl-tRNA synthetase (ProS) from C. pneumoniae (CPn0500), T. pallidum (TP0160, TP0837), C. trachomatis (CT393), and U. urealyticum (UU452), to threonyl-tRNA synthetase (ThrS) from C. trachomatis (CT581), C. pneumoniae (CPn0806), U. urealyticum (UU534), M. genitalium (MG375), M. pneumoniae (MP0289), and to seryl-tRNA synthetase SerS from U. urealyticum
(UU106).

COGS Summary:  COGS Search
BeTs to 15 clades of COG0442
COG name: Prolyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0442 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 448-565 are 83% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000606) which is seen in Q9CL72_PASMU.

Residues 26-99 are 82% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD004144) which is seen in SYP_HAEIN.

Residues 201-433 are 81% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD006954) which is seen in SYP_HAEIN.

Residues 104-200 are 90% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000380) which is seen in SYP_HAEIN.



Paralogs:  Local Blast Search


HD1919 is paralogously related to HD1803 (2e-09) and HD1133 (3e-04).


Pfam Summary:  Pfam Search
Residues 38 to 192 (E-value = 1e-60) place HD1919 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 251 to 385 (E-value = 8.3e-07) place HD1919 in the YbaK family which is described as YbaK / prolyl-tRNA synthetases associated domain (PF04073)
Residues 474 to 568 (E-value = 3.5e-28) place HD1919 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRTSQYLFSTLKETPNDAQVISHQLMLRAGMIRPTAAGLYNWLPTGVKIL
KKVENIIREEMNKGGAIEILMPVVQPAELWQESSRWEQYGPELLRFADRG
KRDFVLGPTHEEVITDLVRRELSSYKQLPLNLYQIQTKFRDEVRPRFGVM
RSREFVMKDAYSFHTTPESLQQTYEVMYQVYHRIFTRLGLDFRTVQADTG
SIGGSASHEFQVLASSGEDDIVFSTESDFAANIELAEAVAMGESKPATEA
MVLIDTPNAKTIAELVAQFDLAIEKTVKTLIVKGANETAPLVALILRGDH
ELNEIKAQKHPLVAEPLAFADEDEIKAKIGVSVGYLGPVNLAIPAIVDRS
VALMSDFVAGANIDGKHYLNINWQRDVVLPEVFDLRNVVVGDPSPDGRGI
LLIKRGIEVGHIFQLGQKYSAAMNATVQGEDGKPLVMTMGCYGIGVTRVV
AAAIEQHHDERGIIWPTDEIAPFTVAIVPMNMFKSASVQAFAEQLYTDLM
AQGVDVILDDRKERPGVMFADMELIGVPHMIVIGEKNLENGEVEYKNRRT
GEKTMIAKDQLLAYLAQNVRA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTACAAGTCAGTATTTATTTTCCACGCTAAAAGAGACTCCAAATGA
TGCTCAGGTGATTAGCCATCAGTTAATGTTACGGGCAGGTATGATTCGCC
CGACAGCTGCAGGGTTATATAATTGGTTACCGACAGGCGTTAAGATATTA
AAAAAAGTAGAAAATATTATTCGTGAAGAAATGAATAAAGGCGGTGCCAT
TGAGATATTAATGCCGGTAGTGCAGCCGGCAGAATTATGGCAAGAATCAA
GCCGTTGGGAGCAGTATGGCCCTGAATTACTTCGCTTTGCCGACCGTGGT
AAACGTGACTTTGTGTTGGGCCCGACTCATGAAGAAGTGATTACTGATTT
AGTGCGTCGCGAGCTTTCTTCCTATAAACAGTTACCGTTAAATCTATACC
AAATTCAAACTAAATTCCGCGATGAAGTTCGTCCGCGTTTTGGGGTAATG
CGTTCACGTGAGTTTGTTATGAAAGATGCTTATTCTTTCCACACTACACC
AGAAAGTTTACAACAAACTTATGAGGTGATGTATCAGGTTTATCATCGAA
TTTTTACGCGCTTAGGTTTAGATTTCCGAACAGTGCAAGCGGATACGGGA
TCGATTGGCGGTTCAGCCTCACACGAATTCCAGGTTTTGGCATCAAGCGG
TGAAGATGATATCGTTTTTTCCACTGAATCTGATTTTGCCGCTAATATTG
AATTAGCCGAAGCGGTGGCGATGGGTGAGTCTAAACCAGCAACTGAAGCG
ATGGTGTTGATTGATACGCCAAATGCTAAAACAATTGCAGAATTGGTTGC
ACAATTTGATTTAGCAATTGAAAAAACGGTTAAAACATTAATTGTGAAAG
GTGCAAACGAAACAGCACCTCTAGTGGCATTAATTTTACGTGGTGATCAT
GAGTTGAATGAGATTAAAGCGCAAAAACACCCATTAGTGGCAGAACCATT
AGCATTTGCAGATGAAGATGAAATTAAAGCTAAAATTGGTGTTAGTGTTG
GCTATCTTGGCCCAGTTAATTTAGCCATACCTGCGATTGTCGATCGTTCC
GTTGCGTTAATGTCAGATTTTGTAGCGGGAGCGAATATTGATGGTAAACA
TTATCTGAATATTAATTGGCAACGTGATGTAGTATTGCCTGAGGTGTTTG
ATTTACGTAATGTGGTTGTTGGTGATCCAAGTCCTGATGGCAGGGGTATC
TTGTTGATTAAACGCGGTATTGAAGTTGGGCATATTTTCCAATTAGGTCA
GAAATATTCTGCCGCCATGAATGCAACTGTACAAGGTGAGGATGGCAAAC
CATTAGTGATGACAATGGGCTGTTATGGTATTGGTGTGACACGTGTAGTG
GCGGCGGCGATTGAACAACATCATGATGAGCGAGGAATTATTTGGCCAAC
GGATGAAATTGCGCCTTTTACTGTGGCGATTGTGCCGATGAATATGTTTA
AGTCAGCGAGCGTGCAAGCATTTGCTGAGCAACTTTATACGGATTTAATG
GCACAAGGCGTAGATGTGATTTTGGATGATCGTAAAGAGCGACCGGGTGT
GATGTTCGCAGATATGGAATTAATCGGTGTACCACATATGATCGTGATCG
GGGAGAAAAACCTAGAAAATGGTGAGGTGGAATATAAAAATCGCCGTACC
GGTGAGAAGACGATGATCGCCAAAGATCAATTGTTAGCCTATTTAGCGCA
AAACGTGCGGGCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy