Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap rRNA-16S-6 IGR1402 IGR1404 IGR1407 IGR1405 IGR1406 IGR1408 IGR1403 IGR1409 IGR1401 IGR1400 udp, - HD1908 udp, - HD1909 asnC, - HD1911 udp, - HD1907 HD1915 murI, - HD1906 HD1920 HD1916 proS, - HD1919 HD1912 yhdM, - HD1917 asnA, - HD1913 udp, - HD1908 udp, - HD1909 asnC, - HD1911 udp, - HD1907 HD1915 murI, - HD1906 HD1920 HD1916 proS, - HD1919 HD1912 yhdM, - HD1917 asnA, - HD1913 udp, - HD1909 asnC, - HD1911 udp, - HD1907 HD1915 murI, - HD1906 HD1920 HD1916 proS, - HD1919 udp, - HD1908 HD1912 yhdM, - HD1917 asnA, - HD1913 HD1918 HD1918
* Calculated from Protein Sequence

Gene ID: HD1913

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
asnA  

Definition:
aspartate--ammonia ligase (asparagine synthetase A)

Gene Start:
1608975

Gene Stop:
1609967

Gene Length:
993

Molecular Weight*:
37312

pI*:
5.70

Net Charge*:
-7.66

EC:
6.3.1.1  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Alanine and aspartate metabolism
Cyanoamino acid metabolism
Nitrogen metabolism

Secondary Evidence:
Nakamura,M., Yamada,M., Hirota,Y., Sugimoto,K., Oka,A. and Takanami,M.
Nucleotide sequence of the asnA gene coding for asparagine synthetase of E. coli K-12.
Nucleic Acids Res. 9(18): 4669-4676, 1981.
Medline: 82059491.

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to asparagine synthetase A (aspartate-ammonia ligase) AsnA from H. influenzae (1168531), Treponema pallidum (7437905), E. coli (4139528, 40998), Lactobacillus delbrueckii (1703442), among others.

HD1913 is similar to asparagine synthetase A (aspartate-ammonia ligase) AsnA from T. pallidum (TP0556) and U. urealyticum (UU363). No similarities to C. trachomatis, C. pneumoniae, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 9-325 are 87% similar to a (LIGASE SYNTHETASE ASPARAGINE COMPLETE) protein domain (PD024629) which is seen in ASNA_HAEIN.



Paralogs:  Local Blast Search
HD1913 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 246 (E-value = 5.1e-189) place HD1913 in the AsnA family which is described as Aspartate-ammonia ligase (PF03590)

PDB Hit:
pdb|12AS|A Chain A, Asparagine Synthetase Mutant C51a, C315a Co... 421 6e-119

Gene Protein Sequence:
MKKSFILQQQEISFVKNTFTQYLIDQLDIIEVQGPILSQVGNGMQDNLSG
IEKAVQVNVKCIPGAVFEVVHSLAKWKRHTLARFGFKQGEGLFVHMKALR
PDEDSLDPTHSIYVDQWDWEKVIPEGQRNFAYLKQTVNQIYKAIRLTELA
VEARFDIPSSLPKQITFIHSEELAQRYPNMSSKERENAICKEHGAIFLIG
IGGKLSDGKAHDGRAPDYDDWTTESENGYKGLNGDILVWNEELGSAFELS
SMGIRVDQQALRLQVSLTGDEDRLTMDWHQDLLAGRLPLSIGGGIGQSRL
VMFLLHKKHIGEVQSSVWPTEMLTQFENIL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAGAGCTTTATTTTACAACAACAAGAAATTAGTTTTGTTAAAAA
CACTTTTACGCAATACCTGATCGATCAATTAGATATTATTGAAGTACAAG
GGCCGATTTTGAGCCAAGTGGGCAATGGTATGCAAGATAACTTATCCGGC
ATCGAAAAAGCGGTACAGGTAAATGTAAAATGCATTCCTGGCGCAGTGTT
TGAAGTTGTACATTCATTAGCCAAATGGAAACGCCACACTTTAGCTCGTT
TTGGTTTTAAACAAGGCGAAGGTTTATTTGTACATATGAAAGCATTGCGT
CCCGATGAAGATTCTTTAGACCCAACACATTCTATTTATGTTGATCAATG
GGATTGGGAAAAAGTAATTCCTGAAGGCCAACGTAACTTTGCTTATTTAA
AACAGACTGTTAATCAAATTTATAAAGCCATTCGTTTAACTGAATTAGCG
GTTGAAGCGCGCTTTGATATCCCATCAAGTTTGCCAAAACAAATTACGTT
CATACATAGCGAAGAATTAGCACAGCGTTATCCAAATATGTCCAGTAAAG
AACGTGAAAATGCGATTTGTAAAGAACACGGTGCGATCTTTTTAATCGGC
ATTGGAGGTAAATTATCTGACGGTAAAGCGCATGATGGTCGTGCACCTGA
TTATGACGATTGGACAACTGAATCTGAAAATGGCTATAAAGGTTTAAACG
GCGATATTTTAGTTTGGAATGAAGAATTAGGCTCTGCCTTTGAATTATCC
TCAATGGGCATTCGTGTTGATCAACAAGCATTACGTTTACAAGTCAGCTT
AACTGGTGATGAAGATCGATTAACGATGGATTGGCATCAAGATTTATTAG
CGGGTCGTTTACCGCTTTCTATCGGCGGTGGTATTGGTCAGTCACGTTTA
GTGATGTTTCTACTACATAAAAAACACATTGGTGAAGTACAATCAAGTGT
ATGGCCAACTGAAATGCTTACCCAATTTGAAAACATTCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy