Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Glu-3 rRNA-16S-6 rRNA-23S-6 IGR1402 IGR1404 IGR1407 IGR1405 IGR1406 IGR1408 IGR1403 IGR1401 IGR1400 udp, - HD1908 udp, - HD1909 asnC, - HD1911 udp, - HD1907 HD1915 murI, - HD1906 HD1916 proS, - HD1919 HD1912 yhdM, - HD1917 asnA, - HD1913 udp, - HD1908 udp, - HD1909 asnC, - HD1911 udp, - HD1907 HD1915 murI, - HD1906 HD1916 proS, - HD1919 HD1912 yhdM, - HD1917 asnA, - HD1913 udp, - HD1909 asnC, - HD1911 udp, - HD1907 HD1915 murI, - HD1906 HD1916 proS, - HD1919 udp, - HD1908 HD1912 yhdM, - HD1917 asnA, - HD1913 HD1918 HD1918
* Calculated from Protein Sequence

Gene ID: HD1907

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
udp  

Definition:
uridine phosphorylase

Gene Start:
1607871

Gene Stop:
1607425

Gene Length:
447

Molecular Weight*:
15840

pI*:
5.30

Net Charge*:
-1.86

EC:
2.4.2.3  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Walton,L., Richards,C.A. and Elwell,L.P.
Nucleotide sequence of the Escherichia coli uridine phosphorylase
udp) gene
Nucleic Acids Res. 17 (16), 6741 (1989)
MEDLINE: 89386014


Comment:
See HD1908, HD1909.

Blast Summary:  PSI-Blast Search
Some significant hits using gapped BLAST to uridine phosphorylase from H. influenzae (1174872), Klebsiella aerogenes (3122987), E. coli (136740), Salmonella typhimurium (6960234), among others.

HD1907 is similar to uridine phosphorylase from T. pallidum (TP1027). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB000845 (Purine and other phosphorylases, family 1) with a combined E-value of 4.1e-24.
    IPB000845C    45-55
    IPB000845D    83-119


ProDom Summary:  Protein Domain Search
Residues 10-145 are 74% similar to a (URIDINE PHOSPHORYLASE TRANSFERASE) protein domain (PD023520) which is seen in UDP_HAEIN.



Paralogs:  Local Blast Search

HD1907 is paralogously related to HD0889 (0.001).


Pfam Summary:  Pfam Search
Residues 1 to 141 (E-value = 1.6e-12) place HD1907 in the PNP_UDP_1 family which is described as Phosphorylase family (PF01048)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VTTGAVRLDGASQHFAPLEYPAVANFECTNAAYAAAIASGATTYVGITAS
SDTFYPGQERYDTFSGKVYPKFQGSLKQWQDLNVMNFEMESGTLFTICSA
LGLRAGMVSGVIVNRTQQEIPNEATIKATEEKAVSVAVETARKLVKLS$

Gene Nucleotide Sequence:  Sequence Viewer
GTGACCACCGGCGCAGTTCGTTTAGATGGCGCTAGCCAGCATTTTGCACC
GCTTGAATATCCAGCGGTCGCTAACTTCGAATGTACTAATGCAGCCTACG
CTGCGGCGATAGCATCTGGTGCGACTACTTACGTTGGTATTACCGCCTCT
TCAGATACCTTCTATCCTGGCCAAGAACGCTACGACACCTTTAGCGGTAA
AGTTTACCCGAAATTTCAAGGCTCATTAAAACAATGGCAAGATCTAAATG
TAATGAACTTTGAAATGGAATCAGGCACATTATTTACCATCTGCTCAGCA
CTAGGTCTACGCGCAGGTATGGTATCAGGCGTCATTGTTAATCGTACTCA
ACAAGAGATTCCAAACGAAGCCACCATCAAAGCAACAGAAGAAAAAGCCG
TTTCTGTAGCAGTAGAAACAGCACGTAAACTAGTTAAACTAAGTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy