Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Glu-3 rRNA-16S-6 rRNA-23S-6 IGR1402 IGR1404 IGR1407 IGR1405 IGR1406 IGR1403 IGR1401 IGR1400 udp, - HD1908 udp, - HD1909 asnC, - HD1911 udp, - HD1907 HD1915 murI, - HD1906 HD1916 HD1912 yhdM, - HD1917 asnA, - HD1913 udp, - HD1908 udp, - HD1909 asnC, - HD1911 udp, - HD1907 HD1915 murI, - HD1906 HD1916 HD1912 yhdM, - HD1917 asnA, - HD1913 udp, - HD1909 asnC, - HD1911 udp, - HD1907 HD1915 murI, - HD1906 HD1916 udp, - HD1908 HD1912 yhdM, - HD1917 asnA, - HD1913
* Calculated from Protein Sequence

Gene ID: HD1906

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
murI  

Definition:
glutamate racemase

Gene Start:
1607269

Gene Stop:
1606457

Gene Length:
813

Molecular Weight*:
30398

pI*:
9.80

Net Charge*:
9.20

EC:
5.1.1.3  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
peptidoglycan biosynthesis

Secondary Evidence:

de Dios A, Prieto L, Martin JA, Rubio A, Ezquerra J, Tebbe M, Lopez de Uralde B, Martin J, Sanchez A, LeTourneau DL, McGee JE, Boylan C, Parr TR Jr, Smith MC.
4-Substituted D-glutamic acid analogues: the first potent inhibitors of glutamate racemase (MurI) enzyme with antibacterial activity.
J Med Chem. 2002 Sep 26;45(20):4559-70.
PMID: 12238935

Doublet,P., van Heijenoort,J., Bohin,J.P. and Mengin-Lecreulx,D.
The murI gene of Escherichia coli is an essential gene that encodes a glutamate racemase activity.
J. Bacteriol. 175(10): 2970-2979, 1993.
Medline: 93259941.

Doublet,P., van Heijenoort,J. and Mengin-Lecreulx,D. Identification of the Escherichia coli murI gene, which is required for the biosynthesis of D-glutamic acid, a specific component of bacterial peptidoglycan.
J. Bacteriol. 174(18): 5772-5779, 1992.
Medline: 92394878.



Comment:
For other "mur" genes, see HD0242 (murE), HD0243 (murF), HD0245 (murD), HD0253 (murA), HD0081 (murB), HD0823 (murC), HD0824 (murG).

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to glutamate racemase from H. influenzae (6166587), E. coli (730081, 2121144, 7415851), Zymomonas mobilis (4511996), among others.

HD1906 is similar to glutamate racemase from T. pallidum (TP0406). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0796
COG name: Glutamate racemase
Functional Class:  M
The phylogenetic pattern of COG0796 is -----q-ceBrhuj--ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001920 (Aspartate and glutamate racemases) with a combined E-value of 4e-42.
    IPB001920A    10-41
    IPB001920B    71-101
    IPB001920C    116-127
    IPB001920D    183-199


ProDom Summary:  Protein Domain Search
Residues 151-224 are 52% similar to a (RACEMASE GLUTAMATE ISOMERASE CELL) protein domain (PD004566) which is seen in MURI_PASMU.

Residues 73-146 are 68% similar to a (GLUTAMATE RACEMASE ISOMERASE SYNTHESIS) protein domain (PD002869) which is seen in MURI_PASMU.

Residues 10-72 are 55% similar to a (RACEMASE GLUTAMATE ALL ISOMERASE) protein domain (PD086945) which is seen in MURI_PASMU.



Paralogs:  Local Blast Search


HD1906 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 225 (E-value = 2.5e-72) place HD1906 in the Asp_Glu_race family which is described as Asp/Glu/Hydantoin racemase (PF01177)

PDB Hit:
pdb|1B74|A Chain A, Glutamate Racemase From Aquifex Pyrophilus ... 95 8e-021

Gene Protein Sequence:
LTIIKMKPTILLYDSGMGGLTVYDEIRKKLPNAHYLYYFDNACFPYSEKP
TEVLVERATKMVQKMAKNYPLDLVVVACNTASTVVLPTLRKIFPFPIVGT
VPAIKPAAALSQTKTIGLLATKGTITRPYVLSLIEQYAPNCQIEKIGSTA
LVELVEQKLQTGVIDLTRLTPIIADWQNHPTLDTVILGCTHFPMAKTELQ
QLLPNVKYFLDSGNAIANRVTHLIMHSPHNQQLEKQRENLAFCTQQNNQF
KQQAKIMQRWGFPQLNTLMI$

Gene Nucleotide Sequence:  Sequence Viewer
TTGACCATCATTAAAATGAAACCAACCATTCTTTTATATGATTCAGGCAT
GGGCGGATTAACCGTTTATGACGAAATCCGCAAAAAGCTACCGAATGCCC
ATTATTTATATTATTTTGATAATGCTTGTTTTCCTTACTCAGAAAAGCCA
ACCGAAGTACTGGTAGAAAGGGCAACTAAAATGGTACAAAAAATGGCTAA
AAATTACCCGCTTGATCTAGTTGTTGTAGCATGCAATACGGCCAGTACAG
TCGTTTTGCCAACACTACGTAAGATTTTCCCCTTTCCAATTGTTGGCACA
GTCCCTGCTATCAAACCAGCAGCTGCATTATCTCAAACTAAAACAATAGG
ATTACTCGCAACGAAAGGTACGATAACCCGCCCTTATGTATTGAGTTTGA
TTGAACAATATGCCCCAAATTGCCAAATTGAAAAGATAGGTTCAACCGCA
TTAGTAGAACTCGTAGAACAGAAATTGCAAACAGGTGTTATCGACCTAAC
CCGTTTAACACCAATCATTGCCGACTGGCAAAATCATCCAACATTAGATA
CCGTAATTTTAGGCTGTACCCATTTCCCAATGGCCAAAACAGAACTGCAA
CAACTGTTACCGAATGTCAAATATTTTCTAGATTCAGGCAACGCAATAGC
GAACCGAGTTACTCATTTAATTATGCACTCCCCACATAATCAACAACTTG
AAAAACAAAGAGAAAACCTAGCGTTCTGTACACAACAAAATAATCAATTT
AAACAGCAAGCAAAGATTATGCAAAGATGGGGATTCCCACAGTTAAATAC
GCTAATGATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy