Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap rRNA-5S-6 rRNA-23S-6 IGR1398 IGR1399 IGR1393 IGR1392 IGR1394 IGR1396 IGR1397 IGR1395 IGR1400 HD1897 slyX, - HD1899 mtn, - HD1898 HD1896 hmwC, - HD1895 HD1904 HD1903 HD1902 HD1901 fklB, - HD1900 HD1897 slyX, - HD1899 mtn, - HD1898 HD1896 hmwC, - HD1895 HD1904 HD1903 HD1902 HD1901 fklB, - HD1900 HD1897 slyX, - HD1899 mtn, - HD1898 HD1896 hmwC, - HD1895 HD1903 HD1901 fklB, - HD1900 HD1904 HD1902
* Calculated from Protein Sequence

Gene ID: HD1900

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fklB  

Definition:
peptidyl-prolyl cis-trans isomerase

Gene Start:
1598296

Gene Stop:
1599030

Gene Length:
735

Molecular Weight*:
26638

pI*:
10.10

Net Charge*:
8.25

EC:
5.2.1.8  

Functional Class:
Cellular processes; Chaperones  
Translation; Protein modification and translation factors  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to probable FkbP-type peptidyl prolyl cis-trans isomerase (PPIase/rotamase) FkpA precursor from H. influenzae (1169691), Aeromonas hydrophila (8134460), E. coli (1169689), Neisseria meningitidis (7226815), among others.

HD1900 is similar to peptidyl-prolyl cis-trans isomerase (MIP-like protein) from T. pallidum (TP0862), C. trachomatis (CT541), and C. pneumoniae (CPn0661). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 5 clades of COG0545
COG name: FKBP-type peptidyl-prolyl cis-trans isomerases 1
Functional Class: O
The phylogenetic pattern of COG0545 is ----Y--cE--h-----lin-
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB000774 (Domain amino terminal to FKBP-type peptidyl-prolyl isomerase) with a combined E-value of 7.5e-45.
    IPB000774A    104-144
    IPB000774B    155-182
    IPB000774C    183-212
    IPB000774D    219-234
***** IPB001179 (FKBP-type peptidyl-prolyl cis-trans isomerase (PPIase)) with a combined E-value of 2.8e-08.
    IPB001179    179-212


ProDom Summary:  Protein Domain Search
Residues 28-138 are 40% similar to a (MACROPHAGE INFECTIVITY POTENTIATOR) protein domain (PD001516) which is seen in Q9CL91_PASMU.

Residues 114-164 are 56% similar to a (ISOMERASE PROTEOME PEPTIDYL-PROLYL) protein domain (PD380787) which is seen in Q9KV04_VIBCH.

Residues 167-235 are 49% similar to a (ISOMERASE ROTAMASE CIS-TRANS PEPTIDYL-PROLYL PPIASE) protein domain (PD000420) which is seen in Q9CL91_PASMU.



Paralogs:  Local Blast Search
HD1900 is paralogously related to HD1868 (5e-04) and HD1867 (5e-04).


Pfam Summary:  Pfam Search
Residues 15 to 138 (E-value = 5.7e-08) place HD1900 in the FKBP_N family which is described as Domain amino terminal to FKBP-type peptidyl-prolyl isomerase (PF01346)
Residues 142 to 232 (E-value = 2.5e-38) place HD1900 in the FKBP_C family which is described as FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254)

PDB Hit:
pdb|1ROT| Structure Of Fkbp59-I, The N-Terminal Domain Of A ... 78 1e-015
pdb|1YAT| Fk-506 Binding Protein (12 Kd, Yeast) Complex With... 72 7e-014
pdb|1PBK| Homologous Domain Of Human Fkbp25 66 4e-012

Gene Protein Sequence:
MLKNKLSTLALVVGTLFASQATFAEKADQAFVNDSSYAVGVLMGKNIQGV
IESQKEVFSYNQEKILVGVQDTLKKTGKLTDEELQKQLKALDTYLAKQES
KIAAEKSKATKEAGDKFRAEYEKKAGVKKTASGLLYKIEKAGTGASPKAE
DIVIAHYKGTLPDGTVFDSSYERNEPIELQLKQLIPAWIEAIPMLKKGGK
MEIVAPPKLAYGDRPSGKVPANATLKFEIELLDFKPTAAQPKKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAAAAATAAACTCTCAACTCTTGCATTAGTAGTAGGTACATTATT
TGCCTCTCAAGCAACATTTGCAGAAAAAGCAGATCAAGCATTTGTGAATG
ATTCATCTTATGCGGTAGGTGTCTTAATGGGTAAAAATATCCAAGGCGTC
ATCGAATCCCAAAAAGAGGTTTTTTCTTATAATCAAGAGAAAATCTTAGT
GGGCGTACAAGATACCTTAAAAAAAACCGGTAAACTTACTGACGAAGAAC
TACAAAAACAATTAAAAGCACTAGATACTTACCTTGCTAAACAAGAAAGC
AAAATAGCTGCTGAAAAAAGTAAAGCAACTAAAGAAGCGGGCGACAAATT
CCGCGCAGAATATGAGAAAAAAGCAGGCGTGAAAAAAACCGCTTCAGGCT
TACTCTACAAAATTGAAAAAGCAGGTACAGGCGCATCACCAAAAGCTGAA
GATATCGTAATAGCACACTACAAAGGCACATTACCAGATGGCACAGTATT
TGATAGTTCATATGAACGCAATGAACCAATCGAACTACAATTAAAACAAT
TAATTCCAGCGTGGATTGAAGCGATTCCAATGCTGAAAAAAGGTGGAAAA
ATGGAAATTGTTGCACCACCTAAATTAGCTTATGGCGACCGCCCATCGGG
CAAAGTACCGGCAAATGCAACATTGAAATTTGAAATTGAATTATTAGATT
TCAAACCAACTGCCGCGCAACCAAAGAAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy