Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1389 IGR1393 IGR1392 IGR1394 IGR1387 IGR1391 IGR1386 IGR1385 IGR1390 IGR1388 HD1897 HD1893 qacE, - HD1891 HD1892 mtn, - HD1898 dprA, - HD1888 HD1896 glmS, - HD1894 hmwC, - HD1895 def, - HD1889 rfaD, - HD1890 HD1897 HD1893 qacE, - HD1891 HD1892 mtn, - HD1898 dprA, - HD1888 HD1896 glmS, - HD1894 hmwC, - HD1895 def, - HD1889 rfaD, - HD1890 qacE, - HD1891 HD1892 mtn, - HD1898 dprA, - HD1888 HD1896 glmS, - HD1894 hmwC, - HD1895 HD1897 HD1893 def, - HD1889 rfaD, - HD1890
* Calculated from Protein Sequence

Gene ID: HD1894

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glmS  

Definition:
glucosamine-fructose-6-phosphate

Gene Start:
1593553

Gene Stop:
1591721

Gene Length:
1833

Molecular Weight*:
66851

pI*:
6.00

Net Charge*:
-12.12

EC:
2.6.1.16  

Functional Class:
Central intermediary metabolism; Amino sugars  

Pathway: pathway table
Aminosugars metabolism
Glutamate metabolism

Secondary Evidence:
Walker,J.E., Gay,N.J., Saraste,M. and Eberle,A.N.
DNA sequence around the Escherichia coli unc operon. Completion of the sequence of a 17 kilobase segment containing asnA, oriC, unc, glmS and phoS.
Biochem. J. 224(3): 799-815, 1984.
Medline: 85121806.

Gay,N.J., Tybulewicz,V.L. and Walker,J.E.
Insertion of transposon Tn7 into the Escherichia coli glmS transcriptional terminator.
Biochem. J. 234(1): 111-117, 1986.
Medline: 86215091.

Dutka-Malen,S., Mazodier,P. and Badet,B.
Molecular cloning and overexpression of the glucosamine synthetase gene from Escherichia coli.
Biochimie 70(2): 287-290, 1988.
Medline: 88281539.


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous strongly significant hits using gapped BLAST to glucosamine-fructose-6-phosphate aminotransferase from H. influenzae (1169920), E. coli (3915705), Neisseria meningitidis (7379038), among others.

HD1895 is similar to glucosamine-fructose-6-phosphate aminotransferase from T. pallidum (TP0861), C. pneumoniae (CPn0968), and C. trachomatis (CT816). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 13 clades of COG0449
COG name: Glucosamine-fructose-6-phosphate aminotransferase, contains aminotransferase and phosphosugar isomerase domains
Functional Class:  M
The phylogenetic pattern of COG0449 is -MtkYqvcebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000583 (Glutamine amidotransferase class-II) with a combined E-value of 9.1e-31.
    IPB000583A    24-34
    IPB000583B    70-79
    IPB000583C    98-126
    IPB000583D    594-609
***** IPB001347 (SIS domain) with a combined E-value of 1.8e-15.
    IPB001347A    71-79
    IPB001347B    342-367


ProDom Summary:  Protein Domain Search
Residues 454-609 are 29% similar to a (PROTEOME COMPLETE) protein domain (PD305006) which is seen in Q9WZS0_THEMA.

Residues 251-331 are 34% similar to a (AMINOTRANSFERASE GFAT) protein domain (PD414311) which is seen in Q9Y093_DROME.

Residues 63-234 are 75% similar to a (AMIDOTRANSFERASE ASPARAGINE AMINOTRANSFERASE GLUTAMINE) protein domain (PD000635) which is seen in Q9KUM8_VIBCH.

Residues 431-509 are 74% similar to a (AMINOTRANSFERASE AMIDOTRANSFERASE) protein domain (PD002268) which is seen in GLMS_PASMU.

Residues 301-428 are 54% similar to a (PROTEOME COMPLETE AMINOTRANSFERASE ISOMERASE) protein domain (PD000868) which is seen in Q9JWN9_NEIMA.

Residues 239-336 are 37% similar to a (AMIDOTRANSFERASE AMINOTRANSFERASE) protein domain (PD414828) which is seen in GLMS_HELPJ.

Residues 2-55 are 79% similar to a (AMIDOTRANSFERASE AMINOTRANSFERASE GLUTAMINE) protein domain (PD001242) which is seen in GLMS_HAEIN.

Residues 534-610 are 75% similar to a (AMINOTRANSFERASE AMIDOTRANSFERASE) protein domain (PD002422) which is seen in GLMS_PASMU.

Residues 243-393 are 75% similar to a (AMINOTRANSFERASE AMIDOTRANSFERASE) protein domain (PD002531) which is seen in GLMS_HAEIN.



Paralogs:  Local Blast Search


HD1894 is paralogously related to HD1209 (2e-15) and HD0477 (0.001).


Pfam Summary:  Pfam Search
Residues 2 to 134 (E-value = 6.2e-61) place HD1894 in the GATase_2 family which is described as Glutamine amidotransferases class-II (PF00310)
Residues 287 to 422 (E-value = 7e-46) place HD1894 in the SIS family which is described as SIS domain (PF01380)
Residues 460 to 596 (E-value = 6.3e-30) place HD1894 in the SIS family which is described as SIS domain (PF01380)

PDB Hit:
pdb|1MOS|A Chain A, Isomerase Domain Of Glucosamine 6-Phosphate... 531 1e-151
pdb|1GDO|B Chain B, Glutaminase Domain Of Glucosamine 6-Phospha... 311 2e-085
pdb|1AO0|A Chain A, Glutamine Phosphoribosylpyrophosphate (Prpp... 89 1e-018

Gene Protein Sequence:
MCGIVGAVAQRDVADILVDGLHRLEYRGYDSAGVAVLNEQHHMQIIRRVG
KVKALEEAVIGEKVFGGTGIAHTRWATHGEPSEINAHPHRSGKIAVVHNG
IIENYEALKVVLQQRGYIFASHTDTEVIAHLVEWELRTAHSLLEAVQKAV
VQLRGAYGTVVMNQDDPTRLVVARSGSPLVIGYGIGENFIASDPLALLSV
THRFAYLEEGDVAEITRHAVAIYNQAGEAVTREIHQGNFEQDAADKGVYR
HYMQKEIFEQPIAIMNTLAGRIKDGQVNIEAIAPNAADILAKVEHIQIVA
CGTSYNAGMVARYWFEEIANISCNVEIASEFRYRKFVVQPNSLLITLSQS
GETADTLAALRLAKQSGYMAAMTICNVASSSLVRESDFAFMTKAGIEIGV
ASTKAFTTQLTCLLLLNVAIGRLKGRLSVAQEQQIVQSLQKLPSQIESAL
VFDKAIEKLSEDFADKQHTLFLGRGEFYPIAMESALKLKEISYIHAEAYA
AGELKHGPLALIDSEMPVVVVAPENDLLEKVKSNIEEVRARGGQLYVFAD
HEAGFEQTVDFKTIVLPRVDAVTAPIFYTVPLQLLSYHIALIKGTDVDQP
RNLAKAVTVE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGTGGAATTGTGGGTGCAGTAGCACAACGTGATGTAGCGGATATTTT
AGTCGATGGATTACATCGATTAGAATATCGTGGCTATGATTCAGCAGGTG
TAGCGGTACTAAATGAACAACACCATATGCAAATTATTCGGCGTGTAGGT
AAAGTCAAAGCCCTTGAAGAAGCTGTGATAGGAGAAAAAGTCTTTGGCGG
CACAGGCATTGCACATACACGTTGGGCAACCCATGGGGAACCGTCCGAAA
TAAATGCACATCCTCATCGTAGTGGCAAAATAGCTGTTGTACATAATGGC
ATTATTGAAAATTATGAAGCATTAAAAGTTGTGTTACAACAACGCGGTTA
TATTTTTGCGTCACACACGGATACAGAAGTAATTGCTCACTTAGTCGAAT
GGGAACTTCGTACGGCACATTCATTATTAGAAGCAGTCCAAAAAGCAGTG
GTACAATTACGTGGCGCTTATGGAACAGTGGTAATGAATCAAGACGATCC
AACTCGTCTAGTTGTCGCACGTTCAGGCAGCCCACTAGTAATTGGTTATG
GTATCGGTGAAAATTTCATTGCTTCCGATCCTTTAGCATTATTGAGTGTA
ACGCATCGTTTTGCTTATTTAGAAGAAGGCGATGTAGCGGAAATTACTCG
CCATGCTGTAGCTATTTACAATCAAGCGGGTGAAGCGGTCACACGTGAAA
TTCATCAAGGCAATTTTGAACAAGATGCTGCAGATAAAGGTGTTTATCGC
CATTATATGCAAAAAGAGATTTTTGAACAGCCGATTGCTATTATGAATAC
CTTAGCAGGTAGGATTAAAGATGGGCAGGTAAATATTGAAGCGATTGCAC
CTAATGCAGCGGATATTTTAGCTAAAGTAGAACATATTCAAATCGTAGCA
TGTGGTACATCTTACAATGCGGGAATGGTTGCTCGTTATTGGTTTGAAGA
AATTGCTAATATAAGTTGTAATGTTGAGATTGCTTCGGAATTTCGTTACC
GAAAATTTGTAGTGCAACCAAACAGCTTGCTTATTACTTTATCACAATCA
GGTGAAACAGCCGATACGCTTGCCGCATTAAGGCTGGCTAAACAGTCCGG
TTATATGGCAGCAATGACGATTTGTAATGTAGCAAGTTCGTCTTTGGTTC
GTGAATCTGATTTTGCTTTTATGACCAAAGCGGGCATTGAAATTGGCGTT
GCGTCCACTAAGGCATTTACTACGCAATTAACTTGCTTATTGTTACTGAA
TGTGGCCATCGGGCGTTTAAAAGGCCGCCTTTCTGTCGCACAAGAACAGC
AAATTGTACAATCATTACAAAAATTGCCTTCCCAAATTGAAAGTGCTTTA
GTTTTTGATAAAGCGATTGAGAAATTATCAGAAGATTTTGCGGATAAGCA
ACATACATTATTTTTAGGGCGAGGTGAATTTTATCCAATTGCAATGGAAT
CTGCATTAAAGTTAAAAGAAATCTCATATATTCATGCAGAAGCTTATGCA
GCAGGTGAATTAAAACACGGGCCTTTAGCATTAATTGATAGTGAAATGCC
GGTGGTGGTAGTCGCGCCTGAAAATGATTTACTCGAGAAAGTAAAATCAA
ATATTGAAGAAGTTCGCGCACGTGGCGGTCAATTATATGTATTTGCTGAT
CACGAAGCGGGCTTTGAACAGACGGTCGATTTTAAAACAATAGTATTACC
GCGTGTTGATGCAGTAACGGCGCCTATTTTTTACACCGTACCATTACAAT
TACTCTCTTATCACATTGCATTAATTAAAGGTACTGATGTTGATCAACCA
CGTAATCTTGCTAAAGCAGTAACAGTCGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy