Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1389 IGR1387 IGR1391 IGR1384 IGR1386 IGR1385 IGR1390 IGR1388 HD1893 qacE, - HD1891 HD1892 dprA, - HD1888 glmS, - HD1894 hmwC, - HD1895 def, - HD1889 rfaD, - HD1890 HD1887 HD1893 qacE, - HD1891 HD1892 dprA, - HD1888 glmS, - HD1894 hmwC, - HD1895 def, - HD1889 rfaD, - HD1890 HD1887 qacE, - HD1891 HD1892 dprA, - HD1888 glmS, - HD1894 hmwC, - HD1895 HD1893 def, - HD1889 rfaD, - HD1890 HD1887
* Calculated from Protein Sequence

Gene ID: HD1891

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
qacE  

Definition:
drug resistance protein QACE

Gene Start:
1590192

Gene Stop:
1589860

Gene Length:
333

Molecular Weight*:
11568

pI*:
8.40

Net Charge*:
1.41

EC:
 

Functional Class:
Other categories; Drug and analog sensitivity  
Transport and binding proteins; Other  

Pathway: pathway table

Secondary Evidence:
Kucken D, Feucht H, Kaulfers P.
Association of qacE and qacEDelta1 with multiple resistance to antibiotics and antiseptics in clinical isolates of Gram-negative
bacteria.
FEMS Microbiol Lett. 2000 Feb 1;183(1):95-8.
PMID: 10650208

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-82 are 46% similar to 19919180_5 QACEdelta1 [Pseudomonas aeruginosa] and to 20086228 ORF3-QacEdelta1 fusion protein [Proteus mirabilis].

Several significant hits using gapped BLAST to quaternary ammonium compound-resistance protein QACE (quaternary ammonium determinant E) from Klebsiella aerogenes (7531185), Plasmid pDGO100 (149119), Enterobacter aerogenes (7531186), Staphylococcus saprophyticus (7531183), among others. Also significant hits to ethidium bromide resistance protein E1 from E. coli (48208) and Pseudomonas aeruginosa (119115). Finally, hits to putative drug resistance proteins from Neisseria meningitidis (7380716, 7225615), and to gacE2 gene product from Pseudomonas aeruginosa (4210828).

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 3 clades of COG2076
COG name: Membrane transporters of cations and cationic drugs
Functional Class: P
The phylogenetic pattern of COG2076 is --------EBr----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000390 (Integral membrane protein, DUF7) with a combined E-value of 2.3e-30.
    IPB000390A    4-25
    IPB000390B    43-97


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1891 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 94 (E-value = 4e-26) place HD1891 in the Multi_Drug_Res family which is described as Small Multidrug Resistance protein (PF00893)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNPWLLLAFTIVIEVVGSSCIKASDGFSKPLPTAVAIGSFVIALYLLSII
TKILPLGIVYAVWSGVGIVLTSLVAYFAFGQKLDLAGGIGITLILLGVLV
INLFSQHSNH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCCCTGGCTTTTATTAGCGTTTACAATTGTGATTGAAGTGGTGGG
CAGTAGTTGTATTAAAGCCAGTGATGGTTTTAGTAAACCATTACCTACGG
CGGTGGCAATTGGTTCTTTTGTCATCGCACTTTATTTATTGTCAATCATT
ACCAAAATACTACCGCTAGGTATTGTCTATGCAGTGTGGTCGGGCGTGGG
AATTGTATTAACCTCGTTAGTTGCCTATTTCGCTTTTGGACAAAAGTTAG
ATCTGGCGGGAGGAATTGGCATCACTTTAATTCTGCTTGGTGTGTTAGTG
ATTAATTTATTTTCACAACATTCCAATCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy