Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1374 IGR1373 IGR1375 IGR1375.1 comM, - HD1872 tyrP, - HD1875 rpoC, - HD1876 rpoB, - HD1877 visC, - HD1874 comM, - HD1872 tyrP, - HD1875 rpoC, - HD1876 rpoB, - HD1877 visC, - HD1874 comM, - HD1872 tyrP, - HD1875 rpoC, - HD1876 rpoB, - HD1877 visC, - HD1874
* Calculated from Protein Sequence

Gene ID: HD1876

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpoC  

Definition:
DNA-directed RNA polymerase, beta' chain (rpoC)

Gene Start:
1576006

Gene Stop:
1572050

Gene Length:
3957

Molecular Weight*:
145478

pI*:
5.70

Net Charge*:
-17.65

EC:
2.7.7.6  

Functional Class:
Transcription; RNA synthesis, modification, and DNA transcription  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Ovchinnikov,Yu.A., Monastyrskaya,G.S., Gubanov,V.V., Guryev,S.O.,
Salomatina,I.S., Shuvaeva,T.M., Lipkin,V.M. and Sverdlov,E.D.
The primary structure of E. coli RNA polymerase, Nucleotide
sequence of the rpoC gene and amino acid sequence of the
beta'-subunit
Nucleic Acids Res. 10 (13), 4035-4044 (1982)
Medline: 82274235

Squires,C., Krainer,A., Barry,G., Shen,W.F. and Squires,C.L.
Nucleotide sequence at the end of the gene for the RNA polymerase
beta' subunit (rpoC)
Nucleic Acids Res. 9 (24), 6827-6840 (1981)
Medline: 82150271


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to DNA-directed RNA polymerase, beta' chain (rpoC). Residues 1-1305 are 84% similar to this enzyme from Pasteurella multocida (15603601|) and residues 1-1306 are 83% similar to this enzyme from Haemophilus influenzae Rd (16272458|).

COGS Summary:  COGS Search


Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


Pfam Summary:  Pfam Search
Residues 1 to 241 (E-value = 1.3e-66) place HD1876 in the RNA_pol_Rpb1_1 family which is described as RNA polymerase Rpb1, domain 1 (PF04997)
Residues 243 to 385 (E-value = 7.9e-83) place HD1876 in the RNA_pol_Rpb1_2 family which is described as RNA polymerase Rpb1, domain 2 (PF00623)
Residues 388 to 543 (E-value = 4.4e-52) place HD1876 in the RNA_pol_Rpb1_3 family which is described as RNA polymerase Rpb1, domain 3 (PF04983)
Residues 568 to 663 (E-value = 7.4e-33) place HD1876 in the RNA_pol_Rpb1_4 family which is described as RNA polymerase Rpb1, domain 4 (PF05000)
Residues 665 to 1220 (E-value = 6.8e-168) place HD1876 in the RNA_pol_Rpb1_5 family which is described as RNA polymerase Rpb1, domain 5 (PF04998)

PDB Hit:


Gene Protein Sequence:
MGHIELACPVAHIWFLKSLPSRIGLILDMPLRDIERVLYFESYVVTEPGM
TDLEKNQLLTEEQYLEAEERWGDEFDAKMGAEGIQVLLRDMDLEHQCEVM
REELQETNSETKRKKITKRLKLLEAFQQSGNKPEWMVMTVLPVLPPDLRP
LVPLDGGRFATSDLNDLYRRVINRNNRLKRLLGLVAPDIIVRNEKRMLQE
SVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSG
RSVITVGPYLHLHQCGLPKKMALELFRPFIYSKLESRGIASTIKAAKKMV
EREEPIVWDILAEVIREHPILLNRAPTLHRLGIQAFEPLLIEGKAIQLHP
LVCAAFNADFDGDQMAVHVPLTLEAQLEARALMMSTNNVLSPASGDPIIV
PSQDVVLGLYYMTRDKVNGKGEGMYFLDPREAEKAYRTGQVELHARVKVR
ITEYSKNEAGEFLAETNLVDTTIGRAILWMIAPKGMPFSVFNQTLGKKAI
SKLINESYRRLGLKESVVLADQIMYTGFAYAARSGVSVGIDDMVIPAQKN
DIITAAEAEVAEIQEQFNSGLVTAGERYNKVIDIWAAANERVAKAMMENL
STEEMLNREGNPEKQASFNSIFMMADSGARGSAVQIRQLAGMRGLMARPD
GSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLV
DVAQDLVITEDDCGTHEGIVMTPLIEGGDVKEALRDRVLGRVVAEDVLKP
GTEQILIPRNTLIDEKWCDVIDVESVDVIKVRSVVTCNTDFGVCAKCYGR
DLARGHLINQGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASAAAKESSIQ
VKNAGTIKLANAKFVTNKEGKIVLTSRNTELTVIDIFGRTKENYKVPYGA
VLSKNDGAEVGVGEIVANWDPHTMPVISEVSGRIQFSDIVDGLTVARQTD
DLTGLSSIVVQDVGERATAGKDLRPALRLVDAKGNDIFIPGTDVAAQYFL
PGKAIVTLDDGAEIAVGEALARIPQESVGTKDITGGLPRVADLFEARKPK
EAAILAEISGIVSFGKETKGKRRLVITPAEGEAFEEMIPKWRQLNVFEGE
MVQRGDIISDGAETPHDILRLRGVHAVTDYIVNEVQEVYRLQGVKINDKH
IEVIVRQMLRKAVITNAYDSEFLEGEQVEVARVKIANRKRAEEGKPLVEF
ERELLGITKASLATESFISAASFQETTRVLTEAAVAGKRDELRGLKENVI
VGRLIPAGTGFAYHQARAKKRVVAEQPFEMPVSKNAFATEADIEAEFEFV
ADEATQNLAALLNATDEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGGCACATTGAATTAGCGTGTCCAGTTGCGCATATTTGGTTCTTAAA
ATCGCTACCATCTCGTATTGGTCTAATTTTAGATATGCCATTACGTGATA
TTGAACGTGTGCTTTATTTTGAATCATACGTAGTAACCGAACCGGGGATG
ACTGATTTAGAGAAAAACCAGTTATTAACCGAAGAACAATATTTGGAAGC
AGAAGAACGTTGGGGCGATGAATTTGATGCGAAAATGGGCGCTGAAGGTA
TTCAAGTGCTGTTACGCGATATGGATTTAGAGCACCAATGTGAAGTGATG
CGTGAAGAGTTACAAGAAACAAATTCAGAAACTAAGCGTAAAAAAATCAC
TAAACGTTTAAAATTACTAGAAGCGTTCCAACAATCAGGTAATAAACCAG
AATGGATGGTAATGACTGTATTACCAGTGCTTCCGCCAGATTTACGCCCA
TTAGTACCGCTTGATGGTGGTCGTTTTGCAACTTCAGATTTAAATGATTT
ATATCGTCGTGTGATTAACCGAAATAATCGATTAAAACGCTTATTAGGCT
TAGTTGCACCGGACATTATCGTACGTAACGAAAAAAGAATGTTACAAGAA
TCTGTCGATGCCTTATTAGATAATGGACGTCGTGGTCGTGCGATTACAGG
TTCTAACAAACGCCCATTAAAATCGTTAGCCGATATGATTAAGGGTAAAC
AAGGGCGTTTCCGTCAGAACTTACTGGGTAAACGTGTTGATTATTCAGGC
CGTTCAGTAATTACGGTTGGTCCATATTTGCACTTACACCAATGTGGTTT
GCCTAAAAAAATGGCATTGGAATTATTCCGCCCATTTATCTACTCTAAAT
TAGAATCACGTGGTATTGCATCAACCATCAAAGCTGCAAAGAAAATGGTT
GAACGTGAAGAGCCGATTGTATGGGATATTTTAGCGGAAGTAATCCGTGA
ACATCCCATTCTGCTCAACCGTGCGCCAACACTTCACCGTTTAGGTATTC
AGGCATTTGAACCATTGTTGATCGAAGGTAAAGCGATCCAATTACACCCA
CTTGTGTGTGCAGCATTCAATGCGGACTTTGATGGCGACCAAATGGCTGT
TCATGTACCGTTAACATTAGAAGCACAGTTGGAAGCGCGTGCGTTAATGA
TGTCAACTAACAACGTCCTTTCACCTGCAAGTGGTGACCCAATCATTGTG
CCTTCTCAGGACGTGGTATTAGGTCTTTACTATATGACACGTGATAAAGT
GAATGGTAAAGGCGAAGGAATGTATTTCCTTGACCCGCGTGAAGCAGAAA
AAGCATATCGTACAGGTCAAGTAGAATTACACGCGCGTGTAAAAGTACGT
ATTACAGAATATAGCAAGAATGAAGCGGGCGAATTTTTAGCAGAAACTAA
TTTAGTGGATACCACTATTGGCCGTGCTATTTTGTGGATGATTGCACCAA
AAGGTATGCCATTCTCAGTGTTCAACCAAACATTGGGTAAAAAAGCGATT
TCAAAATTAATTAATGAAAGCTACCGCCGTTTAGGTTTAAAAGAATCTGT
TGTTTTGGCTGACCAAATTATGTATACCGGTTTTGCATATGCTGCACGTT
CAGGTGTCTCGGTTGGTATTGATGATATGGTTATTCCGGCACAGAAAAAT
GACATTATCACTGCCGCTGAAGCTGAAGTTGCCGAAATTCAAGAGCAATT
TAACTCTGGTTTAGTGACCGCAGGCGAACGTTATAACAAAGTTATTGATA
TTTGGGCAGCAGCGAATGAACGTGTTGCGAAAGCAATGATGGAAAACCTA
TCAACTGAAGAAATGCTCAACCGTGAAGGTAATCCAGAAAAACAAGCATC
ATTTAATAGCATCTTTATGATGGCAGATTCCGGTGCGCGTGGTTCTGCGG
TGCAGATTCGTCAGTTGGCAGGTATGCGTGGTCTAATGGCGCGTCCAGAT
GGCTCGATTATCGAAACGCCAATCACGGCAAACTTCCGTGAAGGCTTAAA
CGTTCTTCAATACTTTATTTCAACGCACGGTGCACGTAAAGGTCTTGCCG
ATACCGCATTGAAAACCGCTAACTCGGGTTATTTAACTCGTCGTTTAGTG
GACGTTGCTCAAGATTTAGTGATCACGGAAGACGATTGTGGTACGCACGA
AGGTATCGTAATGACACCGCTTATTGAAGGTGGTGATGTAAAAGAAGCAT
TACGTGATCGCGTATTAGGTCGTGTGGTTGCTGAAGATGTATTGAAACCA
GGTACTGAACAAATATTGATCCCACGTAATACCTTAATTGATGAAAAATG
GTGTGATGTGATTGATGTAGAATCAGTAGACGTGATCAAAGTACGTTCAG
TCGTAACCTGTAATACAGATTTTGGCGTGTGTGCGAAATGTTATGGCCGT
GATTTAGCACGTGGTCACTTAATTAATCAAGGTGAAGCGGTTGGCGTGAT
TGCTGCACAATCAATCGGTGAGCCGGGTACACAGTTAACGATGCGTACTT
TCCACATTGGTGGTGCGGCTTCTGCAGCAGCGAAAGAATCAAGCATTCAG
GTAAAAAATGCCGGTACGATTAAATTAGCTAATGCTAAATTTGTTACCAA
TAAAGAAGGTAAGATTGTATTAACTTCACGTAATACTGAATTAACCGTGA
TCGACATTTTCGGGCGCACCAAAGAAAACTATAAAGTACCTTACGGTGCA
GTGCTTTCTAAAAATGATGGCGCAGAAGTGGGAGTAGGTGAAATTGTGGC
GAATTGGGACCCACATACAATGCCGGTTATTTCAGAAGTATCAGGTCGTA
TCCAATTCAGCGATATTGTTGATGGTTTAACGGTTGCCCGTCAAACAGAT
GACTTAACAGGTTTATCATCAATCGTTGTGCAAGATGTAGGTGAACGTGC
TACAGCAGGTAAAGACTTACGCCCAGCATTGCGCTTAGTAGATGCAAAAG
GTAATGATATCTTTATTCCTGGCACTGATGTTGCTGCACAATATTTCTTA
CCAGGTAAAGCGATTGTTACGTTAGATGATGGTGCAGAAATTGCCGTTGG
TGAAGCCTTAGCGCGTATTCCACAAGAATCTGTAGGAACTAAAGATATTA
CGGGTGGTTTACCTCGCGTTGCTGACTTATTTGAAGCGCGTAAACCAAAA
GAGGCCGCAATTCTGGCAGAAATTTCAGGTATTGTGTCATTTGGTAAAGA
AACCAAAGGTAAACGTCGCTTAGTGATTACTCCTGCGGAAGGTGAAGCGT
TTGAAGAAATGATTCCTAAATGGCGTCAGCTCAACGTTTTCGAAGGCGAG
ATGGTACAACGTGGTGATATTATCTCTGATGGCGCGGAAACACCGCACGA
TATTTTACGTTTACGTGGCGTGCATGCCGTAACCGATTATATTGTGAATG
AAGTGCAAGAAGTTTACCGCTTACAAGGGGTAAAAATTAACGACAAGCAC
ATTGAAGTGATTGTGCGCCAGATGTTGCGTAAAGCGGTGATTACTAATGC
TTACGATAGTGAGTTCCTAGAAGGCGAACAAGTTGAAGTAGCACGTGTTA
AAATTGCTAACCGCAAACGCGCTGAAGAAGGTAAACCGTTGGTTGAATTT
GAACGTGAATTGCTTGGTATTACCAAAGCATCACTTGCGACTGAATCATT
CATTTCTGCCGCATCGTTCCAAGAAACCACCCGCGTCTTAACTGAAGCGG
CAGTAGCTGGTAAACGTGATGAATTACGTGGCTTGAAAGAGAACGTGATT
GTTGGGCGTTTAATTCCTGCTGGTACAGGTTTTGCTTATCACCAAGCACG
TGCTAAAAAGCGTGTAGTGGCTGAACAACCATTTGAAATGCCAGTAAGCA
AAAACGCATTTGCCACAGAAGCGGATATTGAAGCTGAATTTGAGTTTGTT
GCAGATGAAGCGACCCAAAATTTAGCGGCATTATTAAATGCGACAGATGA
AGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy