Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1371 IGR1370 IGR1374 IGR1369 IGR1373 IGR1372 IGR1375 ppiD, - HD1868 fklB, - HD1867 comM, - HD1870 tyrP, - HD1875 rpoC, - HD1876 deoR,glpR, - HD1863 sgaU, - HD1864 visC, - HD1874 ppiD, - HD1868 fklB, - HD1867 comM, - HD1870 tyrP, - HD1875 rpoC, - HD1876 deoR,glpR, - HD1863 sgaU, - HD1864 visC, - HD1874 fklB, - HD1867 comM, - HD1870 tyrP, - HD1875 rpoC, - HD1876 HD1869 comM, - HD1872 comM, - HD1872 ppiD, - HD1868 HD1869 deoR,glpR, - HD1863 sgaU, - HD1864 visC, - HD1874 araD, - HD1866 araD, - HD1866
* Calculated from Protein Sequence

Gene ID: HD1874

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
visC  

Definition:
probable monooxygenase visC

Gene Start:
1569289

Gene Stop:
1570494

Gene Length:
1206

Molecular Weight*:
44458

pI*:
7.50

Net Charge*:
1.51

EC:
1.14.13.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table

Secondary Evidence:
Nakahigashi,K., Miyamoto,K., Nishimura,K. and Inokuchi,H.
Isolation and characterization of a light-sensitive mutant of Escherichia coli K-12 with a mutation in a gene that is required for the biosynthesis of ubiquinone.
J. Bacteriol. 174(22): 7352-7359, 1992.
Medline: 93054351.

Comment:


Blast Summary:  PSI-Blast Search
Residues 14-400 are 59% similar to 15602867 unknown [Pasteurella multocida].

Otherwise, many significant hits using gapped BLAST to putative monooxygenase VisC and to hypothetical protein sequences;e.g.residues 17-400 are 35% similar to VisC protein in Escherichia coli (138589|).



COGS Summary:  COGS Search
BeTs to 6 clades of COG0654
COG name: 2-Octaprenyl-6-metoxyphenol hydroxylase and related FAD-dependent oxidoreductases
Functional Class: H,C
The phylogenetic pattern of COG0654 is ----Y--cEBR---------x
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB000689 (UbiH/COQ6 monooxygenase family) with a combined E-value of 5.5e-66.
    IPB000689A    17-29
    IPB000689B    168-202
    IPB000689C    212-236
    IPB000689D    293-343
***** PR00420 (Aromatic-ring hydroxylase (flavoprotein monooxygenase) signature) with a combined E-value of 5.9e-20.
    PR00420A    17-39
    PR00420B    166-181
    PR00420C    289-304
    PR00420D    304-320
***** IPB000447 (FAD-dependent glycerol-3-phosphate dehydrogenase) with a combined E-value of 4.1e-06.
    IPB000447A    16-68
***** PR00368 (FAD-dependent pyridine nucleotide reductase signature) with a combined E-value of 4.7e-06.
    PR00368A    17-39
    PR00368C    17-42
***** IPB000171 (Bacterial-type phytoene dehydrogenase) with a combined E-value of 6.9e-06.
    IPB000171A    19-49


ProDom Summary:  Protein Domain Search
Residues 14-77 are 46% similar to a (OXIDOREDUCTASE MONOOXYGENASE FLAVOPROTEIN FAD) protein domain (PD002913) which is seen in Q9CM42_PASMU.

Residues 350-399 are 66% similar to a (PROTEOME FLAVOPROTEIN FAD COMPLETE) protein domain (PD251540) which is seen in Q9CM42_PASMU.

Residues 292-350 are 47% similar to a (OXIDOREDUCTASE COMPLETE PROTEOME FLAVOPROTEIN FAD) protein domain (PD002069) which is seen in Q9KP99_VIBCH.

Residues 186-285 are 59% similar to a (FLAVOPROTEIN FAD OXIDOREDUCTASE) protein domain (PD009774) which is seen in Q9KTD9_VIBCH.

Residues 79-184 are 46% similar to a (PROTEOME PM1002 COMPLETE) protein domain (PD395057) which is seen in Q9CM42_PASMU.

Residues 292-348 are 66% similar to a (MONOOXYGENASE OXIDOREDUCTASE HYDROXYLASE FAD) protein domain (PD000900) which is seen in Q9CM42_PASMU.



Paralogs:  Local Blast Search
HD1874 is paralogously related to HD0582 (4e-49) and HD0579 (5e-26).


Pfam Summary:  Pfam Search
Residues 166 to 359 (E-value = 7.9e-30) place HD1874 in the Monooxygenase family which is described as Monooxygenase (PF01360)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LIIGIIKSAREATMKKDVIIIGGGMVGAATALGLAKLGLNIALIEKKPLP
LFQSDSAYDLRISAISIASVNLLAELGVWQQIQAMRVCRYDSLETWEVEG
FSTRFTAEEIGLDTLGFMVENKLIQMSLWQALNLYSNCQQIVGFAELTAE
YHSAGWTITVDDQTFSTSLIIAADGANSQVRHWAGIGLTSWQYRQHCLLA
TVKTALPTQSVTWQQFFPTGPRAFLPLADQNGCVVWYDAPQRIAELTQLS
PEQLALTIMQNFPTRLGEIEVIQAGSFPLTRQHAQHYTHNGVVLIGDAAH
TINPLAGQGVNLGFKDVKVLLEVIRQALEKGQSFADEQVLKQYQQQRKAD
NLIMQTSMDLFYKAFKSELFPVKVMRNLALMLAEKITPLKKQALKYAIGL
K$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATAATAGGCATCATCAAATCAGCAAGAGAAGCAACGATGAAAAAAGA
TGTGATTATTATTGGTGGCGGTATGGTCGGGGCAGCAACTGCTTTAGGAT
TGGCAAAGTTAGGCTTAAACATTGCGTTGATTGAAAAAAAACCATTACCC
CTCTTTCAATCGGATTCTGCTTATGACTTACGTATTTCTGCAATTAGCAT
TGCTTCCGTAAATTTATTAGCAGAATTAGGTGTATGGCAACAGATCCAAG
CAATGCGTGTTTGCCGTTACGATAGCTTGGAAACTTGGGAAGTTGAAGGC
TTTAGCACCCGCTTTACTGCGGAGGAAATTGGTCTAGATACCTTAGGTTT
TATGGTCGAAAATAAGCTCATTCAAATGAGTTTATGGCAGGCACTTAACC
TCTATTCCAACTGCCAACAAATAGTTGGTTTTGCCGAACTTACTGCTGAA
TATCATTCAGCTGGCTGGACGATTACGGTTGACGATCAAACTTTCTCTAC
CTCATTAATCATTGCCGCAGATGGCGCTAACTCTCAAGTTCGCCATTGGG
CAGGTATCGGACTAACTAGCTGGCAATATCGGCAACACTGTTTACTCGCA
ACGGTTAAAACTGCTTTACCCACTCAATCTGTTACTTGGCAACAATTCTT
TCCAACAGGTCCACGTGCTTTTTTACCGCTTGCAGATCAAAATGGTTGTG
TCGTTTGGTACGATGCACCACAGCGGATTGCCGAACTAACACAGTTATCA
CCTGAACAATTAGCATTAACCATTATGCAAAACTTTCCTACGCGCTTAGG
TGAAATAGAAGTGATACAAGCTGGCAGTTTTCCACTCACTCGCCAACATG
CGCAACACTATACTCACAATGGGGTGGTATTGATTGGAGACGCGGCCCAC
ACGATTAATCCGTTAGCAGGGCAAGGGGTCAATTTAGGTTTTAAAGACGT
AAAAGTATTACTTGAAGTGATCCGCCAAGCGCTCGAAAAAGGGCAATCTT
TTGCTGATGAACAAGTGTTAAAACAGTATCAACAACAACGCAAAGCAGAT
AATTTGATTATGCAGACTAGTATGGACTTATTTTACAAAGCATTTAAAAG
CGAATTATTCCCCGTTAAAGTGATGCGCAATCTGGCTTTAATGTTGGCAG
AGAAAATCACACCACTCAAAAAACAAGCATTGAAATATGCGATTGGGCTT
AAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy