Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1371 IGR1370 IGR1374 IGR1369 IGR1368 IGR1373 IGR1372 IGR1375 IGR1367 ppiD, - HD1868 fklB, - HD1867 comM, - HD1870 tyrP, - HD1875 sgaT, - HD1860 rpoC, - HD1876 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 visC, - HD1874 ppiD, - HD1868 fklB, - HD1867 comM, - HD1870 tyrP, - HD1875 sgaT, - HD1860 rpoC, - HD1876 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 visC, - HD1874 fklB, - HD1867 comM, - HD1870 tyrP, - HD1875 sgaT, - HD1860 rpoC, - HD1876 HD1869 comM, - HD1872 comM, - HD1872 ppiD, - HD1868 HD1869 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 visC, - HD1874 araD, - HD1866 araD, - HD1866
* Calculated from Protein Sequence

Gene ID: HD1868

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ppiD  

Definition:
peptidyl-prolyl cis-trans isomerase

Gene Start:
1567416

Gene Stop:
1567291

Gene Length:
126

Molecular Weight*:
4265

pI*:
4.50

Net Charge*:
-1.78

EC:
5.2.1.8  

Functional Class:
Cellular processes; Chaperones  
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
Rahfeld,J.U., Rucknagel,K.P., Stoller,G., Horne,S.M., Schierhorn,A., Young,K.D. and Fischer,G. 1996. Isolation and amino acid sequence of a new 22-kDa FKBP-like peptidyl-prolyl cis/trans-isomerase of Escherichia coli. Similarity to Mip-like proteins of pathogenic bacteria. J. Biol. Chem. 271(36): 22130-22138. Medline: 96355614.

Comment:


Blast Summary:  PSI-Blast Search
Several weakly significant hits using gapped BLAST to the C-terminus of peptidylprolyl isomerases from E. coli (625740, 729502, 1361166), Aeromonas hydrophila (8134460), among others.

HD1868 is similar to peptidylprolyl isomerase from T. pallidum (TP0862). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0545
COG name: FKBP-type peptidyl-prolyl cis-trans isomerases 1
Functional Class: O
The phylogenetic pattern of COG0545 is ----Y--cE--h-----lin-
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB000774 (Domain amino terminal to FKBP-type peptidyl-prolyl isomerase) with a combined E-value of 1.8e-19.
    IPB000774B    13-40


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1868 is paralogously related to HD1900 (6e-05).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LVNNSTADSTVRVHYTGSLIDGTVFDSSVQRGMPAEFPVGG$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGTCAACAATTCAACAGCAGATAGTACGGTACGTGTACATTATACGGG
TTCTTTGATTGATGGCACGGTATTTGATAGTTCGGTACAACGTGGCATGC
CAGCAGAATTTCCGGTAGGTGGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy