Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1371 IGR1370 IGR1374 IGR1369 IGR1368 IGR1373 IGR1372 IGR1367 ppiD, - HD1868 fklB, - HD1867 comM, - HD1870 tyrP, - HD1875 sgaT, - HD1860 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 visC, - HD1874 ppiD, - HD1868 fklB, - HD1867 comM, - HD1870 tyrP, - HD1875 sgaT, - HD1860 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 visC, - HD1874 fklB, - HD1867 comM, - HD1870 tyrP, - HD1875 sgaT, - HD1860 HD1869 comM, - HD1872 comM, - HD1872 ppiD, - HD1868 HD1869 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 visC, - HD1874 araD, - HD1866 araD, - HD1866
* Calculated from Protein Sequence

Gene ID: HD1866

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
araD  

Definition:
L-ribulose-phosphate-4-epimerase

Gene Start:
1566350

Gene Stop:
1567063

Gene Length:
714

Molecular Weight*:
26552

pI*:
6.30

Net Charge*:
-4.40

EC:
5.1.3.4  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Pentose and glucuronate interconversions

Primary Evidence:
NULL

Secondary Evidence:
Lee,N., Gielow,W., Martin,R., Hamilton,E. and Fowler,A.
The organization of the araBAD operon of Escherichia coli.
Gene 47(2-3): 231-244, 1986.
Medline: 87163495.

Mineno,J., Fukui,H., Ishino,Y., Kato,I. and Shinagawa,H. Nucleotide sequence of the araD gene of Escherichia coli K12 encoding the L-ribulose 5-phosphate 4-epimerase.
Nucleic Acids Res. 18(22): 6722, 1990.
Medline: 91067495.

Lin,H.C., Lei,S.P., Studnicka,G. and Wilcox,G.
The araBAD operon of Salmonella typhimurium LT2. III. Nucleotide sequence of araD and its flanking regions, and primary structure of its product, L-ribulose-5-phosphate 4-epimerase.
Gene 34(1): 129-134, 1985.
Medline: 85232046.

Comment:
Weakly similar to fucA, fuculose -1-P-aldolase.

Blast Summary:  PSI-Blast Search
Residues 9-237 are 81% similar to a proposed L-ribulose-phosphate 4-epimerase sequence of HAEIN (SGBE_HAEIN). Many similarities to other bacterial araD proteins.

Many significant hits using gapped BLAST to L-ribulose-phosphate 4-epimerase AraD from H. influenzae (1074955), E. coli (5002129, 114100), Salmonella typhimurium (1168482), among others. Also several hits to putative pentulose-5-phosphate-4-epimerase from H. influenzae (1168481), E. coli (586722), M. pneumoniae (2492918), among others.

HD1866 is similar to araD from M. pneumoniae (MP0345). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, or M. genitalium.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0235
COG name: Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases
Functional Class:  G
The phylogenetic pattern of COG0235 is amtkyQV-EBrHuj-p----x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001303 (Class II Aldolase and Adducin N-terminal domain) with a combined E-value of 2.4e-37.
    IPB001303A    29-38
    IPB001303B    42-67
    IPB001303C    86-104
    IPB001303D    172-189


ProDom Summary:  Protein Domain Search
Residues 32-120 are 71% similar to a (ADDUCIN PROTEOME COMPLETE ALDOLASE ISOMERASE MEMBRANE) protein domain (PD001906) which is seen in Q9KMS6_VIBCH.

Residues 121-237 are 78% similar to a (ISOMERASE 4-EPIMERASE ZINC SUGAR 5.1.-.-) protein domain (PD317741) which is seen in Q9CLI6_PASMU.



Paralogs:  Local Blast Search
HD1866 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 14 to 224 (E-value = 7e-92) place HD1866 in the Aldolase_II family which is described as Class II Aldolase and Adducin N-terminal domain (PF00596)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLTELSAKLTAMRERVFNANLDLPKYKLITFTWGNVSEIDRETGYVAIKP
SGVEYDTMTVEDIVLVDLDGNRVFGDKKPSSDTATHLAFYRAFANIGGVV
HTHSRHATAWAQTGRDILALGTTQGDYFYGSIPCTRQMTPAEIAGEYELE
TGKVVIETFRTRNIDPDMVPGVLVHSHGPFTWGKDAHDAVHNSVVLEEVA
YMNFVSHQLQPNISSMQQELLDKHYLRKHGKNAYYGQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAACTGAATTATCCGCTAAACTAACCGCTATGCGTGAGCGAGTATT
TAACGCTAATCTAGACTTACCTAAATATAAACTCATCACATTTACTTGGG
GAAATGTCAGCGAAATCGATCGCGAAACAGGTTATGTTGCTATCAAGCCT
TCCGGTGTTGAATACGACACCATGACAGTCGAAGATATCGTATTAGTTGA
TCTAGATGGTAATCGCGTATTTGGCGACAAAAAACCCTCTTCTGATACCG
CCACTCATTTAGCCTTTTATCGTGCTTTTGCCAATATTGGCGGCGTAGTG
CATACCCATTCACGTCATGCAACAGCTTGGGCACAAACTGGTCGCGATAT
CTTGGCACTAGGCACAACTCAAGGCGATTATTTTTACGGCTCAATCCCTT
GTACCCGCCAAATGACCCCTGCTGAAATTGCAGGCGAATATGAATTAGAA
ACCGGTAAAGTAGTCATCGAAACGTTCCGTACACGTAATATTGATCCTGA
TATGGTCCCTGGAGTATTGGTGCATTCGCATGGGCCATTTACTTGGGGAA
AAGATGCTCACGATGCGGTACATAATTCTGTCGTCTTAGAAGAAGTCGCC
TATATGAATTTTGTCAGCCATCAGCTACAGCCGAATATTAGTTCAATGCA
ACAAGAATTGCTCGACAAACATTACTTGCGCAAACACGGTAAAAATGCCT
ATTACGGCCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy