Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1371 IGR1366 IGR1370 IGR1374 IGR1369 IGR1368 IGR1373 IGR1372 IGR1367 ppiD, - HD1868 fklB, - HD1867 sgaA, - HD1859 comM, - HD1870 tyrP, - HD1875 sgaT, - HD1860 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 visC, - HD1874 ppiD, - HD1868 fklB, - HD1867 sgaA, - HD1859 comM, - HD1870 tyrP, - HD1875 sgaT, - HD1860 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 visC, - HD1874 fklB, - HD1867 sgaA, - HD1859 comM, - HD1870 tyrP, - HD1875 sgaT, - HD1860 HD1869 comM, - HD1872 comM, - HD1872 ppiD, - HD1868 HD1869 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 visC, - HD1874 araD, - HD1866 araD, - HD1866
* Calculated from Protein Sequence

Gene ID: HD1864

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
sgaU  

Definition:
hexulose-6-phosphate isomerase (HUMPI)

Gene Start:
1565496

Gene Stop:
1566356

Gene Length:
861

Molecular Weight*:
32939

pI*:
4.90

Net Charge*:
-7.73

EC:
5.-.-.-  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
HD1864 is highly similar to several putative hexulose-6-phosphate isomerase sequences, for example residues 1-286 are 87% similar to SGBU_HAEIN.

Four strong significant hits using gapped BLAST to putative hexulose-6-phosphate isomerase from H. influenzae (1176301), E. coli (6094277, 732031), and M. pneumoniae (2498908). Also one significant hit to a 33.7 kDa hypothetical protein in the avtA-selB intergenic region from E. coli (1073502).

HD1964 is similar to a hypothetical protein from M. pneumoniae (MP0350). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, or M. genitalium.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1082
COG name: Predicted endonucleases
Functional Class: L
The phylogenetic pattern of COG1082 is AMTk--VCEBrH---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-283 are 82% similar to a (ISOMERASE HEXULOSE-6-PHOSPHATE HUMPI) protein domain (PD017663) which is seen in Q9CLI5_PASMU.



Paralogs:  Local Blast Search
HD1864 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 285 (E-value = 2.6e-220) place HD1864 in the Hxl6Piso_put family which is described as Putative hexulose-6-phosphate isomerase (PF03809)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRKYKLGIYEKALPKNISWQDRLSIAKSCGFDFVEMSIDETDERLARLEW
SKEQRLALVNSIVTTGITIPSMCLSGHRRFPFGTRDQATREKAYEIMEKA
IQFAVDTGIRTIQLAGYDVYYEEQDQGTIERFQQGLAWAVELAASNQVTL
AVEIMDTPFMSSISRWKKWDEMINSPWFTVYPDIGNLSAWNDNIEQELAL
GINKISAIHLKDTYKITKDCAGQFRDVPFGDGCVDFKGFFEILAKLNYRG
AFLIEMWTEKAEEPIAEIINARRWIEQKMKEGGFEC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAAAATACAAATTAGGTATTTATGAAAAAGCATTGCCAAAAAACAT
TTCTTGGCAAGATCGGCTTTCAATTGCAAAATCATGTGGGTTTGATTTTG
TAGAAATGTCTATCGACGAAACAGATGAACGTTTAGCTCGTTTAGAGTGG
AGTAAAGAACAACGTCTTGCCTTAGTTAATTCAATCGTTACCACAGGCAT
CACTATCCCCTCTATGTGTTTGTCAGGCCATCGCCGTTTCCCATTTGGCA
CGCGGGATCAGGCAACACGCGAAAAAGCTTATGAAATTATGGAAAAGGCG
ATTCAATTTGCTGTAGATACAGGCATTCGCACCATTCAATTAGCTGGCTA
CGATGTCTATTATGAAGAACAAGATCAAGGAACCATCGAACGTTTCCAAC
AAGGCTTAGCTTGGGCGGTTGAATTAGCCGCCAGTAACCAAGTCACACTG
GCCGTCGAAATTATGGACACCCCCTTTATGAGTTCAATTAGCCGTTGGAA
AAAATGGGATGAAATGATTAACTCACCGTGGTTTACCGTTTATCCTGATA
TCGGCAACCTCTCCGCTTGGAATGATAACATTGAACAAGAACTTGCATTA
GGCATCAATAAAATCTCCGCTATTCATTTAAAAGACACCTATAAAATCAC
TAAAGATTGTGCAGGTCAATTCCGAGATGTACCCTTTGGTGATGGTTGCG
TTGACTTTAAAGGTTTCTTTGAAATATTAGCTAAACTAAATTATCGTGGT
GCTTTCTTAATTGAAATGTGGACAGAAAAAGCTGAAGAACCGATTGCCGA
AATTATCAATGCACGGCGTTGGATTGAGCAAAAAATGAAAGAGGGTGGTT
TTGAATGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy