Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1371 IGR1366 IGR1370 IGR1369 IGR1368 IGR1365 IGR1372 IGR1364 IGR1367 ppiD, - HD1868 fklB, - HD1867 sgaA, - HD1859 sgaH, - HD1857 comM, - HD1870 HD1856 sgaT, - HD1860 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 ppiD, - HD1868 fklB, - HD1867 sgaA, - HD1859 sgaH, - HD1857 comM, - HD1870 HD1856 sgaT, - HD1860 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 fklB, - HD1867 sgaA, - HD1859 sgaH, - HD1857 comM, - HD1870 HD1856 sgaT, - HD1860 HD1869 comM, - HD1872 comM, - HD1872 ppiD, - HD1868 HD1869 deoR,glpR, - HD1863 sgaU, - HD1864 HD1861 araD, - HD1866 araD, - HD1866
* Calculated from Protein Sequence

Gene ID: HD1861

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1563468

Gene Stop:
1564559

Gene Length:
1092

Molecular Weight*:
41152

pI*:
6.20

Net Charge*:
-6.28

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-363 are 75% similar to >15602628 unknown [Pasteurella multocida].

HD1861 is strongly similar to two hypothetical 40 Kd proteins from E. coli, YJFR_ECOLI (gb|AAA97088.1) and pir||S56417. No apparent similarity to HAEIN.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 6 clades of COG2220
COG name: Predicted Zn-dependent hydrolases of the beta-lactamase fold
Functional Class: R
The phylogenetic pattern of COG2220 is AmtKy-VceBR----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-363 are 75% similar to a (PROTEOME COMPLETE VCA0248 PM0763) protein domain (PD135310) which is seen in Q9CMQ2_PASMU.



Paralogs:  Local Blast Search
HD1861 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSKVSEITRESWILSTFPEWGTWLNEEIELEQVPANNVAMWWLGCVGLWV
KTPASANLCIDLWCGRGKATKKVKDMVRGHQMANMAGVRKLQPNLRNSVG
VIDPFAINQVDAIVATHYHNDHIDVNVAAAVINNPALDHVKFIGPQYCVN
MWTKWGVPVERCIVVKLGDSIKIKDLELIALDSFDRTCLVTLPARGAEDN
GGELNGICPSDEEMGLKAVNYLIKTPGGNIYHSGDSHYSIYYAKHGKDYD
IDVALGSYGENPLGIQDKMTSVDILRMAECLRTKVVIPVHHDIWTNFMAS
TNEILELYRMRKDRLQYQFHPFIWEVGGKYVYPRDKDLIEYHHPRGFDDC
FEQDPNVPFKSIL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAAAGTGAGTGAAATTACCAGAGAAAGTTGGATTCTTTCAACATT
TCCAGAATGGGGAACTTGGTTAAATGAAGAAATTGAATTAGAACAAGTAC
CGGCCAATAATGTTGCTATGTGGTGGCTAGGCTGTGTCGGTTTATGGGTA
AAAACACCTGCAAGTGCGAATCTTTGTATTGATTTATGGTGTGGTCGAGG
CAAAGCCACTAAGAAAGTAAAAGATATGGTGCGTGGTCACCAAATGGCTA
ATATGGCGGGTGTACGTAAATTACAACCAAACTTGCGTAACTCTGTAGGC
GTTATCGATCCATTCGCCATCAATCAAGTTGATGCCATCGTAGCAACTCA
CTATCATAATGACCATATTGACGTTAATGTTGCTGCCGCAGTTATCAATA
ATCCAGCATTAGACCATGTCAAATTCATCGGCCCTCAATACTGTGTCAAT
ATGTGGACAAAATGGGGCGTGCCAGTAGAACGTTGTATCGTAGTTAAACT
AGGCGATAGTATTAAAATCAAAGATTTAGAATTGATCGCATTAGATTCCT
TTGACCGTACTTGTTTAGTCACATTACCTGCGCGCGGTGCGGAAGATAAT
GGAGGTGAATTAAATGGCATCTGCCCAAGTGATGAAGAGATGGGCTTAAA
AGCGGTCAATTATTTAATTAAAACGCCAGGTGGCAATATCTATCATTCAG
GTGATTCACACTACTCCATTTACTATGCAAAACACGGTAAAGATTATGAT
ATTGATGTAGCGCTAGGTAGCTACGGCGAAAATCCATTAGGTATTCAAGA
CAAAATGACCTCTGTTGATATTCTCCGTATGGCAGAATGTTTACGTACCA
AAGTCGTTATTCCTGTTCACCACGATATTTGGACTAACTTTATGGCAAGC
ACTAATGAGATTCTTGAGCTTTATCGTATGCGTAAAGATCGCTTACAATA
TCAATTCCACCCATTCATTTGGGAAGTTGGTGGTAAATATGTTTACCCAC
GCGATAAAGATTTAATTGAATATCATCACCCTCGTGGTTTTGATGATTGC
TTTGAACAAGATCCAAATGTTCCATTCAAATCCATTCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy